KEGG   Clostridium acetobutylicum EA 2018: CEA_G2750Help
Entry
CEA_G2750         CDS       T01864                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00010  Glycolysis / Gluconeogenesis
cay00260  Glycine, serine and threonine metabolism
cay00680  Methane metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01120  Microbial metabolism in diverse environments
cay01130  Biosynthesis of antibiotics
cay01200  Carbon metabolism
cay01230  Biosynthesis of amino acids
Module
cay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cay_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G2750 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CEA_G2750 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEA_G2750 (gpmA)
Enzymes [BR:cay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CEA_G2750 (gpmA)
Membrane trafficking [BR:cay04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CEA_G2750 (gpmA)
Exosome [BR:cay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CEA_G2750 (gpmA)
  Exosomal proteins of melanoma cells
   CEA_G2750 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADZ21787
Position
2868458..2869189
Genome map
AA seq 243 aa AA seqDB search
MRKLVLLRHGQSEWNKENRFTGWTDVDLSVDGVSEAAQAGRILKKNNYTFDAAYTSVLKR
AIRTLQIVLYEMDLLWIPVYKSWKLNERHYGALQGLNKDETRDKYGEDQVHLWRRSVEVR
PPALEKSDKRYPGNEKKYASLKEEELPVTENLEDTEKRVLQDWRELIAPNIKGGKNIIIS
AHGNTLRALVKYLDNIPSDGIANLNIPTGTPLVYELDENLEPITRYYLGMDGKIEDDKFP
KKV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaacttgtgttattaagacacggtcaaagcgaatggaacaaagaaaacagattt
actggctggactgatgttgatttatctgtagatggagttagcgaagccgctcaagcagga
agaatactgaaaaaaaataactatacctttgatgctgcttatacttcagtgcttaaaaga
gccataagaacacttcaaatagttctatatgaaatggaccttctatggatacccgtctat
aaatcctggaaattaaacgaaagacattatggtgcacttcaaggactaaacaaagatgaa
actagagataaatatggagaagatcaagttcatctttggaggcgttctgttgaggtaaga
ccgcctgctttagaaaaatctgataaaagataccccggtaatgaaaaaaaatatgcttcg
ttaaaggaagaagaattgcctgttactgaaaatctagaagatacagaaaaaagggtttta
caggactggcgtgaattaatagctcctaatataaagggaggtaagaatattataatttct
gctcatggaaatactctaagagctcttgtaaaataccttgacaacataccaagcgatgga
atagcaaatttaaatattcctactggaacccctttagtctatgagcttgatgaaaatttg
gaaccaataacacgctattacttaggtatggatggaaaaatagaggatgataaattccct
aaaaaagtttaa

DBGET integrated database retrieval system