KEGG   Clostridium acetobutylicum EA 2018: CEA_G2750Help
Entry
CEA_G2750         CDS       T01864                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CEA_G2750 (gpmA)
   01230 Biosynthesis of amino acids
    CEA_G2750 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G2750 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CEA_G2750 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEA_G2750 (gpmA)
Enzymes [BR:cay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CEA_G2750 (gpmA)
Exosome [BR:cay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CEA_G2750 (gpmA)
  Exosomal proteins of melanoma cells
   CEA_G2750 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2868458..2869189
Genome map
AA seq 243 aa AA seqDB search
MRKLVLLRHGQSEWNKENRFTGWTDVDLSVDGVSEAAQAGRILKKNNYTFDAAYTSVLKR
AIRTLQIVLYEMDLLWIPVYKSWKLNERHYGALQGLNKDETRDKYGEDQVHLWRRSVEVR
PPALEKSDKRYPGNEKKYASLKEEELPVTENLEDTEKRVLQDWRELIAPNIKGGKNIIIS
AHGNTLRALVKYLDNIPSDGIANLNIPTGTPLVYELDENLEPITRYYLGMDGKIEDDKFP
KKV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaacttgtgttattaagacacggtcaaagcgaatggaacaaagaaaacagattt
actggctggactgatgttgatttatctgtagatggagttagcgaagccgctcaagcagga
agaatactgaaaaaaaataactatacctttgatgctgcttatacttcagtgcttaaaaga
gccataagaacacttcaaatagttctatatgaaatggaccttctatggatacccgtctat
aaatcctggaaattaaacgaaagacattatggtgcacttcaaggactaaacaaagatgaa
actagagataaatatggagaagatcaagttcatctttggaggcgttctgttgaggtaaga
ccgcctgctttagaaaaatctgataaaagataccccggtaatgaaaaaaaatatgcttcg
ttaaaggaagaagaattgcctgttactgaaaatctagaagatacagaaaaaagggtttta
caggactggcgtgaattaatagctcctaatataaagggaggtaagaatattataatttct
gctcatggaaatactctaagagctcttgtaaaataccttgacaacataccaagcgatgga
atagcaaatttaaatattcctactggaacccctttagtctatgagcttgatgaaaatttg
gaaccaataacacgctattacttaggtatggatggaaaaatagaggatgataaattccct
aaaaaagtttaa

DBGET integrated database retrieval system