KEGG   Corynebacterium argentoratense: CARG_07220Help
Entry
CARG_07220        CDS       T02821                                 

Definition
hypothetical protein
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
caz  Corynebacterium argentoratense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CARG_07220
Enzymes [BR:caz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CARG_07220
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CARG_07220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494864..1497593
Genome map
AA seq 909 aa AA seqDB search
MSAANWCENAVFYEVLVRTFQDSNGDGVGDFEGLESRLDYLQWLGVDCLWLPPFFASPLD
DGGYDVADFLSTHPDFGSVEQLSHLLDAAHARGMRVIADLPLNHTSIAHQWWREELEALR
AIDAGTLDAADFTPCYVWSTTGEEYADARVIFEDTETSNWTFEPSVGRFYWHRFFSHQPD
LNYDNPAVQEDMLDVLRFWLSKGLDGFRLDAVPYLYERHGTNGENLPETHDYLARVRAMV
DEEFPGCVLIAEANQWPRDVVDYFGSDEAPECHMCFHFPLMPRIFLSFARGEASSIDRIL
ADTPQLPAGAVWGTFLRNHDELTLEMVDDVERADLYARYAPEPRMRANVGIRRRLLPLLG
SAEAVECAVAMLLSMPGAPFLYYGDEIGMADDIWLVDRDGVRTPMQWDGSTNAGFSPQSS
YPPVLSTVPNVQAALADPTSLLYAHRRLIAQRKAVFDASDDWRVVASTKVFAFERAGVLC
AFNVTAEPQSVTVAGIEVYLPGYGYAWVPLVDRVLPHLVGQRFYGGSADSSAVRIVRAEP
WQFGGVWLTVESAGALYRTLVDATGRDLLAQYAAEGDDAAGAGVGVDVVGYVRALLAERG
HTLVGDVQAQRVGGEQSNTSFVVGSWVVKFQRRLAEGVNPEVLVAEALADCPHAAHVVAH
DEGACVATVVPLVDGARDGWELALERGLVGDDSGEGIDVAGLGVAIARVHTALDEGHVQR
RENLLDSLRERMIRTGTQAGLGDALSSGLIEVLSNTGAGSDQVPVQHVHGDLHLGQVLWD
SSRWVLIDFEGEPAATPAERAAEHSPMKDLAGMIRSFDYATQVRARENAASSSTAADAGA
SAGAGVVEQATQALLDGYRQAGGTVDEALLQAYLLDKVLYEYDYELHYRPDFRYIPARAL
RALGIATPE
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcaaactggtgtgaaaacgcagtgttttatgaggtgcttgtgcgcactttc
caggattccaacggcgacggtgtcggcgatttcgagggtttggaatcccgccttgattat
ctgcagtggttgggtgttgattgtttgtggctgcccccatttttcgcctcccctttggac
gatgggggttatgacgtcgcggatttcttgtcgactcacccggatttcggttccgtcgag
cagctgtcgcatctgcttgacgccgcccacgcccgcggcatgcgggtgattgcggatttg
ccgcttaaccacacaagtatcgcccaccagtggtggcgtgaagagctggaggccttgcgt
gcgatcgatgcgggaaccttggatgctgcagacttcaccccgtgctacgtgtggtccacg
accggcgaggaatacgccgatgcccgggtgatttttgaagacaccgagacctccaactgg
accttcgaacccagcgtgggccgcttttattggcaccgctttttctcccaccaaccggac
ttgaattacgacaatcctgcagtgcaagaagacatgctggatgtgttgcgcttctggctg
agcaaggggcttgatggtttccggctagatgctgtcccctacctctacgaacgccacggc
actaatggtgaaaaccttcccgaaacgcacgactatttggcacgcgtgcgcgccatggtc
gatgaggaatttcccggctgtgtgctgattgctgaagcaaaccagtggccccgcgacgtc
gttgattatttcggttccgatgaggcaccggaatgccacatgtgtttccatttcccgctg
atgcctaggatttttctttccttcgcgcgcggtgaggcctcgtcgatcgaccggattctg
gcggacacgccacagctgccagcgggtgcggtgtggggtaccttcctgcgcaaccacgac
gaactcaccctggagatggttgatgatgtcgagcgcgcggacctctatgcccgctacgcc
ccggagccgcgtatgcgggcgaatgtggggatccgccggcgcctgctgccgctgctgggt
tctgcggaggccgtggaatgcgcggtggcgatgttgttgtccatgcccggcgcgccgttt
ttgtattacggggacgaaattgggatggccgacgacatttggttggtcgatcgcgatggt
gtgcgcacgccgatgcagtgggatgggtcgaccaatgcgggtttttcgccccagtcatct
tatcctccggtgttgtcgacggtgccgaatgtgcaggcagcgttggcggatcctacctcg
ctgttgtatgcccacaggcgattgattgcgcagcgtaaggcggtttttgatgcctctgat
gattggcgcgttgttgcttccactaaggtctttgcgttcgagcgcgcaggggtgttgtgt
gcttttaatgtcacggctgagccgcagtcggtgacggttgcgggtatcgaggtgtacctg
cctggctatggctacgcgtgggtgccgttggtggatcgagtgttgccgcatctggtgggc
cagcgtttctatggcggtagtgcggattcttccgcggtgcggattgttcgcgcggagccg
tggcagttcggtggggtgtggttgacggttgagtctgcgggcgcgctgtaccgcacgttg
gttgatgccaccggtcgggatctgttggcgcagtatgctgccgaaggtgatgacgccgcg
ggggctggggttggtgtggatgttgtcggctatgtgcgtgctttgttggctgagcgcggg
cacacgttggtcggtgatgtgcaggcgcagcgcgtgggcggcgagcagtccaacacgtct
tttgttgtgggctcgtgggtggtgaagttccagcgtcgcttggctgagggggtgaatccg
gaggtcctggtggcggaagcgttggctgattgcccgcatgcggcacacgtggtggcgcat
gatgagggtgcttgtgtggccaccgtggtgccgttagttgatggcgctcgcgatggctgg
gagttagccctagagcgtggactggtcggcgatgatagcggcgagggtattgacgtcgcg
gggcttggggtagcaatcgcgcgcgttcataccgcgttggatgaaggccacgtgcagcgg
cgcgagaatctgctcgatagtcttcgcgagcggatgattcgcactggcacgcaggcgggc
ttgggtgatgcgctgagctcagggttgattgaggttctttccaacactggagccgggtct
gatcaggtgccggtgcagcatgtgcatggtgatctccatttgggccaggtgctgtgggat
tcttcccgctgggtgctcattgatttcgagggtgagcccgccgccaccccggcggagcgt
gctgcggagcattccccgatgaaggacctcgccgggatgattcgttcctttgactacgcc
acccaggtgcgcgcacgcgaaaacgcagccagtagcagcactgcagccgacgccggtgcc
agtgccggcgccggcgttgtcgagcaggctactcaggcgctgctggatggttaccggcag
gcaggcggcacggtcgatgaggcactgttgcaggcttatctgttggacaaggtgctctat
gagtacgactatgagctgcactaccgcccggattttcgctacattccggccagggctctg
agagcgctggggatcgccacgcccgagtga

DBGET integrated database retrieval system