KEGG   Clostridium botulinum Ba4: CLJ_B1242Help
Entry
CLJ_B1242         CDS       T00895                                 

Definition
putative beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1280707..1282152
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYGIQP
IVTLSHYETPLHLSKAYDGWKCREMIGFFNKYVCTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIHQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWETLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILKNTVDFISF
SYYMSICESSDKSIRAGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELGDGTKTVLDDYRISYLRDHLIQVSEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDETGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaattttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcgtggtcaagaatattcccaatgggggatgaaaaagaagcaaatgag
aagggattacaattttatgatgatgtttttgatgagtgcttaaagtatggcatacagcca
atagtaacattgtcccattatgaaacaccattgcatttatctaaagcgtatgatggatgg
aaatgtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcgatat
aaaaataaagtaaaatattggttaacttttaatgaaattaattcaattactcatgcgcca
tttttaagtggcggaatttatacaccaatagaaaaattaagtaagcaagaaattcatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgtcatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggagactcttaataaagaaagagagaattttttcttttcagatatt
caagttcgcggttattatccctcatattcaaaaagattctttaaagaaaataatattaaa
ttagatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagtgataaatctattagggcaggtgaaggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattatatgatcgttatcaaaagccattattt
atagttgaaaatggattaggagctgtagatgaattagttgagttaggagatggaacaaaa
acagtattagatgattatagaatttcatatttaagagatcatttaattcaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttgggggtgcattgatctggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatgagacagggacattagaacgttataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcactatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system