KEGG   Clostridium botulinum B Eklund 17B: CLL_A1017Help
Entry
CLL_A1017         CDS       T00696                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cbk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031842..1032687
Genome map
AA seq 281 aa AA seqDB search
MNKNVETFIGCDNNYDESKIVIFGAPFDSTTSFRPGTRFASKVMRSESFGIETYSIYQDR
DLEDICIFDGGDLELSFGNPENALTDIENFTAKLINDNKIPCMIGGEHLVTLGAFRAISK
KYPDIHVIHFDAHADLRDEYLGQKLSHATVMHRVWDIIGDNRIFQFGIRSGEKNEIYWGR
NHVFTNKFNFHRLEEIIKELKEKPVYFTLDLDVLDPSVFPGTGTPEAGGVTFMELLKAIL
DVSKLNIVGMDINELCPIYDQSGSSTALACKVLRELLLSIY
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatgtagaaacttttatagggtgtgacaataattatgatgaatcaaaaata
gttatttttggagcaccttttgattcaacaacatcatttagaccaggaacaagatttgcc
agcaaagtaatgagaagtgagtcttttggaattgaaacttatagcatatatcaagatagg
gacttagaagatatatgcatttttgatggaggagatttagaacttagttttggaaatcca
gaaaatgcattaactgatattgaaaattttacagctaagttaattaatgataataaaata
ccatgtatgattgggggagaacacttagttacattaggagcatttagagctataagtaaa
aaatatcctgatattcatgttatacatttcgatgctcatgcagatttaagagatgaatat
ttaggtcaaaagttatctcatgcaacagttatgcatagggtatgggatataattggagat
aatagaatatttcaatttgggattagatcaggagagaagaatgaaatatattggggacga
aatcatgtatttaccaataaatttaattttcatagattagaagaaattattaaagaatta
aaagaaaaaccagtatactttacattggatttagatgtattagatccatcagtatttcca
gggacaggaactcccgaagcaggtggtgttacttttatggaattattaaaagctatatta
gatgtaagtaaattaaatattgtaggaatggatataaatgaactttgcccaatatatgat
caaagtggaagttcaacagcattagcttgcaaagtattaagggaattgttacttagtatt
tattaa

DBGET integrated database retrieval system