KEGG   Clostridium botulinum B Eklund 17B: CLL_A1734Help
Entry
CLL_A1734         CDS       T00696                                 

Definition
lysophospholipase l2 pldb, hydrolase of alpha/beta superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLL_A1734
Enzymes [BR:cbk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CLL_A1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1819316..1820425
Genome map
AA seq 369 aa AA seqDB search
MNLLNYKRNINYKVLLFLLMFTLNIIFGANQIAYADENEKTAINNLVIEEDDYEESMKGT
VEPYIASKRVEGYFKVNDDINLYYQKYKVENSKGTIVISHGFTETLEKYKEVIYYFLNKG
YSVYGIEHRGHGRSGSLGVVDESQINIEDFNLYISDFKAFIDDIVKPEIGDEKLFLFAHS
MGGAIGTKFLEEYPGYFDAAILSAPMLEIDTGSVPSFIAKSISWIYTTLPFGYKYAPTQK
PYSNEYSLEDSCTSSEPRYKYYYDIQSNNKEFQRGGSSFSWLKSSLDITEEITKKENASK
VEIPVLLFQAEKDTYVKPKGQNEFSQYAPKCKLVLMAGSKHEIYREKDGILKAYLNQIFD
FYNDNLLDN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgttaaattataaaagaaatataaattataaggtattattatttttattaatg
tttactctaaatataatatttggagcaaatcaaattgcttatgctgatgaaaatgaaaaa
acagcaattaataatctagtaatagaagaagatgattatgaggagtctatgaaaggaaca
gtagaaccttatattgcaagtaaaagagtagaaggatattttaaagtaaacgatgatatt
aatctttattatcaaaaatataaagttgagaattctaagggtactattgtaattagccat
ggattcactgaaacactagaaaaatataaagaagtgatttattattttttaaataaagga
tactctgtttatggaattgaacatagagggcatggacgttcgggttcattgggagtagtt
gatgaaagtcaaattaatatagaagattttaatttatatatttcagattttaaagcgttt
atagatgatattgttaaacctgaaattggtgatgaaaaattattcttatttgcacattct
atgggtggtgcaattggaactaaatttttagaagaatatccaggatattttgatgccgct
attttaagtgcaccaatgcttgagattgacactgggagtgttcctagctttatagcaaaa
tctatatcttggatatatacaacattaccatttggttataaatatgcgcctacacaaaaa
ccatatagtaatgaatatagtttagaggattcttgtacaagctctgaaccaagatacaag
tattattatgatatacaatctaataacaaggagtttcaaagaggtggatcttcttttagt
tggttaaaatcatctttagatataacagaagaaattactaaaaaagaaaatgcttcaaaa
gtagaaatcccagtactgttatttcaagcagaaaaggatacctatgtaaaaccaaaagga
caaaatgaattttctcagtatgcacctaagtgtaagcttgtattaatggctggttctaaa
catgaaatatatagagaaaaagatggaatactgaaagcatatttaaatcaaatatttgat
ttttataatgataatttattggataattaa

DBGET integrated database retrieval system