KEGG   Castor canadensis (American beaver): 109703004
Entry
109703004         CDS       T04791                                 
Name
(RefSeq) mitogen-activated protein kinase 10-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01522  Endocrine resistance
ccan04010  MAPK signaling pathway
ccan04012  ErbB signaling pathway
ccan04014  Ras signaling pathway
ccan04024  cAMP signaling pathway
ccan04068  FoxO signaling pathway
ccan04071  Sphingolipid signaling pathway
ccan04137  Mitophagy - animal
ccan04140  Autophagy - animal
ccan04141  Protein processing in endoplasmic reticulum
ccan04210  Apoptosis
ccan04215  Apoptosis - multiple species
ccan04217  Necroptosis
ccan04310  Wnt signaling pathway
ccan04380  Osteoclast differentiation
ccan04510  Focal adhesion
ccan04530  Tight junction
ccan04620  Toll-like receptor signaling pathway
ccan04621  NOD-like receptor signaling pathway
ccan04622  RIG-I-like receptor signaling pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04657  IL-17 signaling pathway
ccan04658  Th1 and Th2 cell differentiation
ccan04659  Th17 cell differentiation
ccan04660  T cell receptor signaling pathway
ccan04664  Fc epsilon RI signaling pathway
ccan04668  TNF signaling pathway
ccan04722  Neurotrophin signaling pathway
ccan04723  Retrograde endocannabinoid signaling
ccan04728  Dopaminergic synapse
ccan04750  Inflammatory mediator regulation of TRP channels
ccan04910  Insulin signaling pathway
ccan04912  GnRH signaling pathway
ccan04914  Progesterone-mediated oocyte maturation
ccan04917  Prolactin signaling pathway
ccan04920  Adipocytokine signaling pathway
ccan04926  Relaxin signaling pathway
ccan04930  Type II diabetes mellitus
ccan04931  Insulin resistance
ccan04932  Non-alcoholic fatty liver disease
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan04935  Growth hormone synthesis, secretion and action
ccan04936  Alcoholic liver disease
ccan05010  Alzheimer disease
ccan05012  Parkinson disease
ccan05016  Huntington disease
ccan05017  Spinocerebellar ataxia
ccan05020  Prion disease
ccan05022  Pathways of neurodegeneration - multiple diseases
ccan05132  Salmonella infection
ccan05133  Pertussis
ccan05135  Yersinia infection
ccan05142  Chagas disease
ccan05145  Toxoplasmosis
ccan05152  Tuberculosis
ccan05161  Hepatitis B
ccan05162  Measles
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05169  Epstein-Barr virus infection
ccan05170  Human immunodeficiency virus 1 infection
ccan05171  Coronavirus disease - COVID-19
ccan05200  Pathways in cancer
ccan05208  Chemical carcinogenesis - reactive oxygen species
ccan05210  Colorectal cancer
ccan05212  Pancreatic cancer
ccan05231  Choline metabolism in cancer
ccan05415  Diabetic cardiomyopathy
ccan05417  Lipid and atherosclerosis
ccan05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109703004
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109703004
   04012 ErbB signaling pathway
    109703004
   04014 Ras signaling pathway
    109703004
   04310 Wnt signaling pathway
    109703004
   04668 TNF signaling pathway
    109703004
   04068 FoxO signaling pathway
    109703004
   04071 Sphingolipid signaling pathway
    109703004
   04024 cAMP signaling pathway
    109703004
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109703004
   04137 Mitophagy - animal
    109703004
  09143 Cell growth and death
   04210 Apoptosis
    109703004
   04215 Apoptosis - multiple species
    109703004
   04217 Necroptosis
    109703004
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109703004
   04530 Tight junction
    109703004
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109703004
   04621 NOD-like receptor signaling pathway
    109703004
   04622 RIG-I-like receptor signaling pathway
    109703004
   04625 C-type lectin receptor signaling pathway
    109703004
   04660 T cell receptor signaling pathway
    109703004
   04658 Th1 and Th2 cell differentiation
    109703004
   04659 Th17 cell differentiation
    109703004
   04657 IL-17 signaling pathway
    109703004
   04664 Fc epsilon RI signaling pathway
    109703004
  09152 Endocrine system
   04910 Insulin signaling pathway
    109703004
   04920 Adipocytokine signaling pathway
    109703004
   04912 GnRH signaling pathway
    109703004
   04914 Progesterone-mediated oocyte maturation
    109703004
   04917 Prolactin signaling pathway
    109703004
   04926 Relaxin signaling pathway
    109703004
   04935 Growth hormone synthesis, secretion and action
    109703004
  09156 Nervous system
   04728 Dopaminergic synapse
    109703004
   04723 Retrograde endocannabinoid signaling
    109703004
   04722 Neurotrophin signaling pathway
    109703004
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109703004
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109703004
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109703004
   05208 Chemical carcinogenesis - reactive oxygen species
    109703004
   05231 Choline metabolism in cancer
    109703004
  09162 Cancer: specific types
   05210 Colorectal cancer
    109703004
   05212 Pancreatic cancer
    109703004
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109703004
   05170 Human immunodeficiency virus 1 infection
    109703004
   05161 Hepatitis B
    109703004
   05171 Coronavirus disease - COVID-19
    109703004
   05162 Measles
    109703004
   05167 Kaposi sarcoma-associated herpesvirus infection
    109703004
   05169 Epstein-Barr virus infection
    109703004
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109703004
   05135 Yersinia infection
    109703004
   05133 Pertussis
    109703004
   05152 Tuberculosis
    109703004
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109703004
   05142 Chagas disease
    109703004
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109703004
   05012 Parkinson disease
    109703004
   05016 Huntington disease
    109703004
   05017 Spinocerebellar ataxia
    109703004
   05020 Prion disease
    109703004
   05022 Pathways of neurodegeneration - multiple diseases
    109703004
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109703004
   05418 Fluid shear stress and atherosclerosis
    109703004
   05415 Diabetic cardiomyopathy
    109703004
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109703004
   04936 Alcoholic liver disease
    109703004
   04932 Non-alcoholic fatty liver disease
    109703004
   04931 Insulin resistance
    109703004
   04933 AGE-RAGE signaling pathway in diabetic complications
    109703004
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109703004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109703004
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109703004
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109703004
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 109703004
NCBI-ProteinID: XP_020043804
UniProt: A0A8B7WJJ7
Position
Unknown
AA seq 294 aa
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKRYNMSKSKVDNQFHSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDRILLSSQWSLWVSFSINSPLFQRQHCG
NT seq 884 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggatttgataaacaagtggatgtgtcatacattgccaaacgttacaacatgagt
aagagcaaagtcgacaaccagttccacagtgtggaagtgggagactcaaccttcacggtt
ctcaagcgctaccagaacttaaagccaattggctctggggctcagggaatagtttgtgct
gcatatgatgctgtccttgacagaaacgtggccattaagaagctcagcagaccctttcag
aatcaaactcacgccaagagagcataccgggagctggtcctcatgaagtgtgtgaaccat
aagaacattattagcttattaaatgtcttcacaccccaaaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcaaatggaa
ttagaccacgaacgaatgtcttacctgctataccaaatgttgtgtggtatcaagcatctc
cactctgcggggattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatccttgactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttactacagagcccccgaggtcattctgggaatgggctac
aaggagaacgtcgacatgtggtcagtagggtgcatcatgggagaaatgataaaaggtgca
gtgctgtttcctggcactgatcgtatccttcttagcagccagtggtctttatgggtgtca
ttctcaattaattcccctttgtttcaaaggcaacactgcggatg

DBGET integrated database retrieval system