KEGG   Clostridium cellulovorans: Clocel_2159Help
Entry
Clocel_2159       CDS       T01294                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clocel_2159
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocel_2159
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocel_2159
Enzymes [BR:ccb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocel_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2573478..2574248)
Genome map
AA seq 256 aa AA seqDB search
MSNLKERLENRLAKNQKFFVAYVMVGEESLEKTYEDVLFLEKAGATLIELGVPFSDPVTD
GVVIQESGIKSLKNGTTLADVLALVEKIRKVSDIPLLLMGYLNPFYKYGFENFFKEARRV
GVEGVIIPDLPLEEFPLISDYVKNYGIDYIPFFSPTTPIERINSLCEVGGGFLYVVTSLG
VTGEKDLDKESLRKALKEIKSHSSLPIAAGFGISSKEDIAGIIDSCDGVIVGTKIIKLLR
ANDYKGLEDLMEGFRV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttaaaggaacgtttagaaaatagacttgcaaaaaatcaaaagttctttgta
gcatatgttatggtgggtgaagaatctcttgaaaaaacttatgaagatgtattgttttta
gaaaaggccggtgcaacattaatagaacttggcgtacctttttcagatccagtaactgat
ggagttgtaattcaagaaagtggaatcaaatccttgaaaaatggaactactttagctgat
gttttagctttggtagaaaaaattagaaaggtttcagatattccgctattgcttatggga
tatctaaatccattctataagtatggttttgaaaacttcttcaaagaagctagaagagta
ggtgtcgaaggagtaataattccagatctaccgttagaagaattcccactaatttcagat
tacgtaaagaattatggcatagactacatcccatttttctcaccaacaacgccaatagaa
agaattaatagtttatgtgaagttggtggtggtttcctatatgttgtaacatctcttggt
gtaacaggagaaaaggatttagacaaggagtcattaagaaaagctcttaaagaaattaaa
tcacattcttctcttcctattgcagcaggctttggaatcagttcgaaggaagacatagct
ggaatcatcgatagttgtgatggagttatcgtaggaactaaaataattaagcttcttaga
gcaaatgactataaaggactagaagatttaatggaaggttttagggtataa

DBGET integrated database retrieval system