KEGG   Coprinopsis cinerea: CC1G_12332Help
Entry
CC1G_12332        CDS       T01275                                 

Definition
ubiquitin C-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CC1G_12332
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CC1G_12332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 429 aa AA seqDB search
MDSYQMHSQPTPIDLVGGPFAVIESDPGVFTSLVRKLGVRGVEVVEVYGIEPWALDHLRP
YGLVFCFLWHKDNHRAADFEDPAAGSVWFANQLSDDACATHAILNVILNCPGIDVGPYLT
QFKQETSQMSPVMRGLPADVRGAINTLATTTLDIEKEKQKEERRKKVAAGKPPPAKKRKG
DDAAQDKSKGKSRQEEEEIEQSYHFIGYVPAHGKVWELDGFKSGPLEVGELPAPESPHQS
GSDPRNTWMDVVRPALRLKMDKYGGSGDDGSNIQFSLLAIVDDGYQAAFDDLELLKREKV
DLALWEDTITGNDRQALFSFNELDRPALASKRMERDIEIMAMSQGELVTAWNSCVRNIRK
AVIVLEDELSKGRRTNTEHINRTFDYEPFFKAFITALHNEGHLNPLLDLDENGKKRRSTT
GMKGGQSKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggattcttaccaaatgcactctcagcctacacccatcgacctagtcggcggaccgttt
gctgttattgagtcggatcctggcgtctttacctccctcgtgcggaaactcggcgtacgg
ggggtcgaagttgtcgaggtttatggaatagaaccttgggccttggatcacctcaggcca
tacgggcttgtattctgcttcctgtggcacaaagataatcaccgtgcggcagacttcgag
gatcctgctgccgggagtgtctggttcgccaaccagctcagcgatgacgcatgtgcgacc
catgcgatcctaaatgtgatcttgaattgcccagggatcgatgttgggccgtatctcact
cagttcaagcaagagacgagtcagatgtcccccgtgatgaggggcctaccagctgatgtt
cgcggtgccattaataccctggcgacgacgacgctggatatcgagaaagagaagcagaaa
gaagagcgtcggaagaaggttgcagctggaaagcctcctccagccaaaaagcgaaagggt
gacgatgcggctcaagataagagcaagggaaagtcaaggcaggaggaggaggagattgaa
cagagctatcatttcataggctatgtcccagctcatggcaaagtctgggaactggacgga
ttcaagtctggcccgctggaagtcggagaactgccagctcccgagtcgcctcaccagagt
ggatctgatccaaggaacacttggatggatgtcgtacgtccagctctgcgtttgaagatg
gacaaatacggagggtcgggggacgatgggagtaacatccagtttagccttttggctatt
gtcgacgatgggtatcaggctgcgtttgacgacctcgagttactgaaacgagaaaaagta
gatctagcgttgtgggaggacacgatcaccggtaatgaccgacaggccttattctccttc
aatgaactcgatagaccggcccttgcgtccaagcgaatggagcgagacatcgagataatg
gccatgtcacaaggggagttggtcactgcttggaactcttgcgtccgcaacatcaggaag
gcagtgatcgtgctcgaagatgaattatccaaaggcaggaggacaaatactgagcacatc
aaccgcacattcgactatgagcctttcttcaaggcattcatcaccgccctccacaatgaa
ggtcacttgaatcccttgcttgacctagacgagaatggtaagaaacgaaggtcaacaacc
ggtatgaagggtgggcagagcaagagatag

DBGET integrated database retrieval system