KEGG   Clostridium clariflavum: Clocl_0134Help
Entry
Clocl_0134        CDS       T01661                                 

Definition
helicase, putative, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ccl  Clostridium clariflavum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clocl_0134
Enzymes [BR:ccl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clocl_0134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147989..150202
Genome map
AA seq 737 aa AA seqDB search
MLITFEGIIEEIIFSNEINGYTVCELRGEKETITAVGFMPFINVGEMIKVSGNWITHPDY
GEQLKVELYEKILPKTVEAIETYLASGLIKGVGPASAKKIVKRFGEDTINIIEFHPERLS
EIKGISHEKALRIGHAYHEQKELRNVVMFFQEYGISPTYCAKIYQIYGKDTIEVIRNNPY
KLSDEAIGINFKTADRIAKSIGIDPKSKFRICSGIKYVLSHIAMDGHTFAEEDKLKDYTS
KLLDVDLDNINDALISLLLDKSIYIERNETSSRVYLSAFYNAEAGVARKLAQLSSVRFEG
DLSDFDEKISEVQKKEGIILTQNQKDAIREALINGVLIITGGPGTGKTTIIKSIINFLIN
EGYEVLLAAPTGRAAKRMTEATGFEAKTIHRLLEMGYASKDDELVFARNEDNPIDADVVI
IDEMSMVDILLMNHLLKAIEIGTRLILVGDVDQLPSVGPGKVLQDLINSDVIKTVRLKEI
FRQAEESYIIVNAHRINNGEKPLLNNKEKDFFFVTRNSPEDIVKTIVDLCVRRIPCAYGF
EPMKEIQVLTPVRKGLVGVGNLNTELQALLNPKDKSKKEKVFRDFLFREGDRVMQIKNNY
NLRWWKDDGKGSEGAGVFNGDTGIIREIDDEEQKIVVFFDDDKVVEYDFSILDELEPAFA
MTIHKSQGSEFPVVIIPIFPGPQVLMTRNLLYTAVTRAKNLVVLVGNKDYLDVMINNERE
TNRNSGLAEKLRVCFGI
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgttgattacttttgagggaataattgaagaaattatattttcaaatgaaataaacggt
tatacagtatgcgagcttagaggtgaaaaggagactataacagccgttggatttatgccc
tttatcaatgtgggagagatgattaaggtgtcagggaattggataactcaccctgactat
ggagagcagcttaaagttgaactatatgaaaaaatacttcctaaaaccgttgaagctata
gagacatatcttgcatcagggcttataaagggagtaggtccggcgagtgcaaagaagatt
gttaaaagatttggggaagatactataaatattattgagtttcatcccgagagattatcc
gaaataaagggcataagccacgaaaaagctttgagaatcggacatgcttatcatgagcaa
aaagaactaaggaatgtagtaatgttctttcaggaatacggtatcagtccgacatactgt
gcaaagatataccagatttatggcaaagacactatagaagtaatccggaataatccatac
aaactatccgatgaagcaataggcattaattttaaaactgccgacagaattgcaaagagt
atcggtatagatccaaaatcgaaattcagaatttgcagcggtataaaatatgttttgtct
catattgcaatggacgggcatacttttgcagaagaggacaagctgaaagattatacatcc
aaactgctggacgtagacttggataatattaatgacgctttaataagtttgttactggac
aaatcaatatatatagaaagaaacgagacttcttcaagagtatatttaagtgctttttac
aatgctgaagcaggtgttgccagaaaacttgcccaactttccagtgttagatttgaagga
gatttaagcgatttcgatgagaaaatatctgaggttcaaaaaaaagagggaattatactt
acacaaaatcaaaaagatgccataagagaagctttgataaatggagtgcttattattacc
gggggaccgggtaccggaaagaccactattattaaaagtataatcaactttttgataaat
gaaggctatgaagttttgcttgcagcaccaacgggcagagctgcaaagagaatgacagaa
gccacggggtttgaagcaaaaactattcacaggcttttggagatgggttatgcctcaaag
gatgacgaattggtgtttgcaagaaacgaagataatcctatagatgccgatgttgttatt
attgacgagatgtcgatggttgacatactcctaatgaaccatttgcttaaagccattgaa
attgggacaagactgatattggtaggagatgtggaccagcttccttcggtgggaccggga
aaggttttacaggatttgataaatagtgatgtgataaagacggtcagattgaaagaaata
ttcagacaggctgaagaaagctatataattgtcaacgcccacagaattaacaatggagag
aagcctttattgaataataaggagaaggatttcttctttgtgacaagaaattcgccggaa
gatattgtaaagaccattgttgacctttgtgtcaggagaataccctgtgcctatggtttt
gaacctatgaaagaaattcaggttctaacccctgtaagaaaaggacttgtgggagtagga
aatcttaatacggaactccaggcattgctgaatcctaaggacaaaagtaaaaaagagaaa
gtttttagagatttccttttcagagaaggcgatagggtaatgcagataaaaaataactat
aatcttagatggtggaaagatgacggcaaaggcagcgaaggtgccggagtttttaatggc
gacaccggaataatcagagaaatagacgacgaagaacaaaaaatagttgtattttttgac
gatgataaagtagtggaatatgacttcagtatactggacgagctggagcctgcttttgct
atgactattcacaaaagtcaaggatcggagtttccggttgtcataattcctatatttccg
gggcctcaggttctgatgacgagaaatctgctttatacggctgttacaagggctaaaaac
cttgtagtacttgtagggaataaagattatttggatgtaatgataaataatgaaagggag
acaaacagaaattccggcctggcagaaaaacttagagtatgttttggtatttaa

DBGET integrated database retrieval system