KEGG   Caulobacter crescentus NA1000: CCNA_01804Help
Entry
CCNA_01804        CDS       T00841                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ccs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ccs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928226..1928708
Genome map
AA seq 160 aa AA seqDB search
MAMSIYDYSAKTLDGQDVSLADYRGQVLLIVNTASKCGFTPQYEGLEALYKAHKDRGFTV
LAFPCNQFGAQEPGNAEEIANFCSLTYDVSFPVMSKIDVNGADAHPLYKFLKKEQKGVLG
TEAIKWNFTKFLIGKDGQVVDRFAPTVKPEDLKVAVEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtcgatctacgactattccgccaagacgctggacggccaggacgtgagcctg
gccgactatcgcggccaagtgctgctgatcgtgaacaccgccagcaagtgcgggttcacg
ccgcagtacgagggcctggaagcgctctacaaggcgcacaaggaccgtggcttcacggtc
ctggccttcccctgcaatcagttcggcgctcaggagccgggtaacgccgaggaaatcgcg
aacttctgctcgctgacctacgacgtgagcttcccggtcatgagcaagatcgacgtcaac
ggcgccgacgcccacccgctctacaagttcctcaagaaggaacagaagggcgtcttgggc
accgaggcgatcaagtggaacttcaccaagttcctgatcggcaaggacggccaggtcgtc
gatcggttcgcgccgaccgtgaagcccgaagacctgaaggtcgcggtcgaggcgctgctc
tag

DBGET integrated database retrieval system