KEGG   Caulobacter crescentus NA1000: CCNA_02365Help
Entry
CCNA_02365        CDS       T00841                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCNA_02365
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CCNA_02365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2505205..2507520)
Genome map
AA seq 771 aa AA seqDB search
MRTLKTFALASAATLIATAAQAAPTTWAYSAKTGVGASYEAYVDGAYKAGGKTGAVSKVW
FSIADGVLTETMYGLIHEAQIKQMRVAVETASGLAIEGADTTSKTEYLHVDAAGRPLSPA
YKITTTDRQGRFVIEKRIFTDPDRNALFVRVTVTALKGAVTPTLLLEPHMANTGGGDVGA
ASASALTAHEGKAFLSLKASKPFAKASASVLKDGDALAALKATTTSAKGAIVLAGELPKV
AKSETFDVVIGFGADAKAADRTAAATLKTGYAEVLARYNGEGAHVGWEDYLASLNELPRL
RDASEDGGKLLQASALMLKVQEDRTYAGALIASLSNPWGDTVDATKSSTGYKAVWPRDFY
QCAMALAALGDKETPLAAFHYLPTVQVGPKTPGNKGDGGWFLQKSHVDGTPEWVGVQLDQ
TAMPIMLGWKLWTWGWLPDAELKAFYGKMLKPAADFLVKGGKVNLDWNTATITPPFTQQE
RWEEQGGHSPSTTAAVIAGLVVAGDIAEAAGDAGSAELYRKTADDCAGKLEARMVTTKGT
FGDGHYYLRLNSDQDPNNKSPVEARNGQAPVAEDKMLDAGFLELVRYGVRRADDPAILAS
LPEIDDEALEDLYRVRYSFTFPGVEGSFPGWRRYGVDGYGEDTKTGANYGADNQMRPGQR
GRVWPIFTGERGHYELAVAGLSGKPDPTAVQKIRDTYVKAMELFANEGLMIPEQVWDGVG
TDSAHGYVRGEGTDSATPLAWSHAEYVKLLRSVSDGQVWDHYAPVKARYAR
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgttgaaaaccttcgccctggcctcggccgcgaccctgatcgccaccgccgcc
caggccgcgcctacgacctgggcctattcggccaagaccggtgtcggcgcctcctacgag
gcctatgtcgacggcgcctacaaggccggcggcaagaccggggcggtgtcgaaggtctgg
ttctcgatcgccgacggggtcctcaccgagacgatgtacggcctgatccatgaggcgcag
atcaagcagatgcgcgtcgccgtcgagacggcgagcggcctggccattgagggggcggat
acgacctccaagaccgagtatctgcatgtggacgccgccggccggccgctgtctccggcc
tacaagatcaccacgaccgatcgccaaggccggtttgtcatcgaaaagcgcatcttcacc
gatcccgaccgcaatgcgctgttcgtgcgcgtgacggtgacggccctgaaaggcgcggtc
acgccgaccctgctgctggagccgcacatggccaacaccggcggtggcgatgtgggcgcg
gcctcggcctcggcgctcaccgcccacgagggcaaggcgttcctcagcctgaaggccagc
aagccctttgcgaaagcctcggccagcgttctgaaggatggcgatgctctggcggctttg
aaggcgaccacgacttcggccaagggcgcgatcgtgctggccggagagctgcccaaggtc
gccaagtccgagacctttgacgtggtgatcggcttcggcgctgacgccaaggccgccgac
cggaccgccgccgcgacgctgaagacgggctacgccgaggtcctggcccgctacaacggc
gagggcgcgcatgtgggctgggaggactatctggcctcgctgaacgaactgccgcgactg
cgcgacgcgtccgaggacggcggcaagcttctccaggccagcgccctgatgctcaaggtg
caggaagaccgcacctatgccggcgccctgattgcctcgctgtccaacccctggggcgac
acggtcgacgcgaccaagtcctcgaccggctacaaggccgtctggccgcgcgacttctat
cagtgcgccatggccttggcggccctgggcgacaaggagacgccgctggcggccttccac
tatctgcccacggtccaggtcgggcccaagacgccgggcaacaagggcgacggcggctgg
ttcctgcagaagtcgcacgtcgacggcacgcccgagtgggtcggggtccagctcgaccag
acggccatgccgatcatgctgggctggaagctctggacgtggggctggctgccggacgcc
gagctgaaggcgttctacggcaagatgctgaagccggcggccgacttcctggtcaagggc
ggcaaggtcaatctggactggaacaccgcgaccatcactccgcccttcacccagcaggag
cgctgggaagaacagggcggccactcgccctcgacgaccgccgccgtcattgcaggcctg
gtggtcgccggcgacatcgccgaggccgccggcgacgccggctcggccgaactctatcgc
aagaccgccgacgactgcgccggcaagctcgaggcccggatggtcacgacgaaggggacc
ttcggcgacggccactattatctgcgtctcaacagcgaccaggacccgaacaacaagagc
ccggtcgaggcgcgtaacggccaggctccggtggccgaggacaagatgctggacgcgggc
ttcctggagctggtgcgctatggcgttcgccgcgccgatgatccggcgatcctggccagc
ctgccggagattgatgacgaggccctcgaagacctctaccgcgttcgctacagcttcacg
ttccctggcgtggagggcagcttccccggctggcgccgctacggcgtcgacggctacggc
gaggacaccaagaccggcgccaactacggcgccgacaaccagatgcgtcccggccaaagg
ggccgggtgtggccgatcttcaccggcgagcgtgggcactacgagctggccgtggcgggc
ctctcgggcaagcccgatcccaccgccgtgcagaagatccgcgatacctacgtcaaggcg
atggagttgttcgccaacgagggactgatgatccccgagcaggtctgggacggcgtcggg
accgacagcgctcatggctatgtccggggcgaggggaccgattcggccacgcccctggcc
tggagccacgcggagtacgtcaagctgctgcgatcggtcagcgacgggcaggtctgggat
cactatgcgcccgtaaaggcgcggtacgcgcgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system