KEGG   Campylobacter curvus: CCV52592_0610Help
Entry
CCV52592_0610     CDS       T00576                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ccv  Campylobacter curvus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ccv00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ccv00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ccv00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ccv00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1771406..1772419
Genome map
AA seq 337 aa AA seqDB search
MKNINKNNAIKTAIFVVFFSLDLFGGASELFKKAQQLESAGDTAGAMKFYKEAAKAAMEQ
NDAALTQNLENEISQGSPIQANYPVKPEPSSNKSESNLEKVASDPLGIKLYHFNYLLPAT
YAKNVPNDGRKRFETKFQFSVQKPLFYDVWGLKESIGIAYSQTSWWQTDKISAPFRETNY
RPEIFIDFDTKDSLKAAHISNVRGGILHESNGRDGENSRSWNRLYLQAKFDFANLSLTPR
IWTVIDDKSDNKNIENYAGRADINIAFTYKEQIFNLMVRNNLQFDKTNRGAAEFSWLFPI
LSSGLYGYLQYFNGYDESLIDYNSHTNKIGIGFTLLK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaataaaaataacgccatcaagaccgccattttcgtcgtattttttagc
ctcgatctatttggaggtgcgagcgagctttttaaaaaagcgcaacagctagaaagtgcc
ggtgatacggcaggagcgatgaaattttacaaagaagccgccaaggccgccatggagcaa
aatgacgccgcccttacgcaaaatttagaaaacgaaatttcacaaggttcgccgatccag
gcgaactaccctgtaaagccagagccaagcagcaacaaaagcgagtcgaatttagaaaag
gtagcgagcgatccgcttggcatcaagctttatcatttcaactacctcttgcccgcgacc
tacgctaaaaacgtgccaaacgacggacgaaagaggtttgagacgaaatttcagttcagc
gtgcaaaaacctcttttttacgatgtttgggggcttaaagagagcatcggcatagcgtat
tcgcagacgtcgtggtggcagacggacaagatatctgcgccgtttcgagagacgaactac
cgacctgaaatttttatcgattttgacaccaaagatagcctgaaagccgctcatatcagc
aatgtaagaggcggaattttacacgagtcaaacggccgtgacggtgaaaattcgcgtagc
tggaacaggctttatttgcaggctaaattcgactttgcgaacctaagcctgacgcctagg
atatggaccgtcatagacgataagagcgacaacaaaaatatagaaaactacgccggcaga
gccgatataaacatagcttttacctataaagagcagatatttaatctaatggtgcgaaac
aacctgcaatttgataaaacaaaccgcggtgcagccgagtttagctggctattcccgata
ctttcaagcggtctttacggatatttgcagtattttaacggatatgacgagagcttgatc
gactacaatagtcacaccaacaagatcggtatcggctttacgctgcttaaatga

DBGET integrated database retrieval system