KEGG   Campylobacter curvus: CCV52592_0610Help
Entry
CCV52592_0610     CDS       T00576                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ccv  Campylobacter curvus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCV52592_0610
   00565 Ether lipid metabolism
    CCV52592_0610
   00590 Arachidonic acid metabolism
    CCV52592_0610
   00591 Linoleic acid metabolism
    CCV52592_0610
   00592 alpha-Linolenic acid metabolism
    CCV52592_0610
Enzymes [BR:ccv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CCV52592_0610
    3.1.1.32  phospholipase A1
     CCV52592_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1771406..1772419
Genome map
AA seq 337 aa AA seqDB search
MKNINKNNAIKTAIFVVFFSLDLFGGASELFKKAQQLESAGDTAGAMKFYKEAAKAAMEQ
NDAALTQNLENEISQGSPIQANYPVKPEPSSNKSESNLEKVASDPLGIKLYHFNYLLPAT
YAKNVPNDGRKRFETKFQFSVQKPLFYDVWGLKESIGIAYSQTSWWQTDKISAPFRETNY
RPEIFIDFDTKDSLKAAHISNVRGGILHESNGRDGENSRSWNRLYLQAKFDFANLSLTPR
IWTVIDDKSDNKNIENYAGRADINIAFTYKEQIFNLMVRNNLQFDKTNRGAAEFSWLFPI
LSSGLYGYLQYFNGYDESLIDYNSHTNKIGIGFTLLK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaataaaaataacgccatcaagaccgccattttcgtcgtattttttagc
ctcgatctatttggaggtgcgagcgagctttttaaaaaagcgcaacagctagaaagtgcc
ggtgatacggcaggagcgatgaaattttacaaagaagccgccaaggccgccatggagcaa
aatgacgccgcccttacgcaaaatttagaaaacgaaatttcacaaggttcgccgatccag
gcgaactaccctgtaaagccagagccaagcagcaacaaaagcgagtcgaatttagaaaag
gtagcgagcgatccgcttggcatcaagctttatcatttcaactacctcttgcccgcgacc
tacgctaaaaacgtgccaaacgacggacgaaagaggtttgagacgaaatttcagttcagc
gtgcaaaaacctcttttttacgatgtttgggggcttaaagagagcatcggcatagcgtat
tcgcagacgtcgtggtggcagacggacaagatatctgcgccgtttcgagagacgaactac
cgacctgaaatttttatcgattttgacaccaaagatagcctgaaagccgctcatatcagc
aatgtaagaggcggaattttacacgagtcaaacggccgtgacggtgaaaattcgcgtagc
tggaacaggctttatttgcaggctaaattcgactttgcgaacctaagcctgacgcctagg
atatggaccgtcatagacgataagagcgacaacaaaaatatagaaaactacgccggcaga
gccgatataaacatagcttttacctataaagagcagatatttaatctaatggtgcgaaac
aacctgcaatttgataaaacaaaccgcggtgcagccgagtttagctggctattcccgata
ctttcaagcggtctttacggatatttgcagtattttaacggatatgacgagagcttgatc
gactacaatagtcacaccaacaagatcggtatcggctttacgctgcttaaatga

DBGET integrated database retrieval system