KEGG   Campylobacter curvus: CCV52592_1686Help
Entry
CCV52592_1686     CDS       T00576                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccv  Campylobacter curvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCV52592_1686 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCV52592_1686 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCV52592_1686 (trpB)
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCV52592_1686 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1605071..1606435)
Genome map
AA seq 454 aa AA seqDB search
MFCKQCNIVLCVVKSYETTLSPPILREAIADRQNRAICSAPCGANKICETFKRHKFKKDK
KVNKKAYFGKFGGQFVPETVMFALNELEEAYEKIAKTSEFEAELDDLLRHYVGRPSPLYH
AKRLSAHYGHEIYLKREDLNHTGAHKINNALGQALLAQKMGKKKVLAETGAGQHGVASAT
AAALLGLECDVYMGATDVARQQLNAFRMQLLGANVISIEEGLKTLKEATTAAIQAWVNEI
ESAFYIIGSAVGPHPYPKIVRDLQSVIGRETKEQLAEFGVKPDYIVACVGGGSNAIGIFS
AFLDDTDVHLIGVEAAGLGADTPYHAATLTKGREGIIHGMKTIVLQDSYGMIAPVHSISA
GLDYPGVGPEHSHLHDIKRAHYEGVTDDECIEALKLTSRLEGIIPAIESSHALAYLAKLC
PTLSGKKTIVVNVSGRGDKDMNTVMGYEKGKIYG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcaagcagtgcaatatcgtgctgtgcgtagtcaaatcttatgaaacgacgcta
tcgccgccgattttgagggaagcgatagctgaccgccaaaatcgtgctatatgttcggcg
ccttgcggagcaaataagatttgcgaaacatttaaaaggcacaaatttaaaaaggacaaa
aaagtgaataaaaaagcatattttggaaaatttggcgggcagttcgtgcccgagaccgtt
atgtttgcgctaaacgagctggaagaggcgtatgaaaagatcgccaaaacgagcgagttt
gaggccgagctggacgatcttttaaggcattatgtcggtcgcccaagtccgctatatcac
gccaaacgcctaagtgcgcactacgggcatgaaatttacttaaagcgcgaggatctaaac
cacacgggcgcacacaagatcaataacgcgctggggcaagccctgctagctcaaaaaatg
ggtaaaaaaaaggtgctggctgagaccggagcggggcagcacggcgtggcgagcgcgact
gcggcggcacttttgggcttagagtgcgacgtgtatatgggcgcgaccgatgtggcgcgt
cagcagctaaatgcgtttaggatgcaactgcttggcgcaaacgtcattagcatcgaagag
ggtctaaaaacgctcaaagaggcgaccacggcggcgattcaggcgtgggtgaatgagata
gaaagcgcattttacatcatcggctcggcggtcggcccgcacccgtatccaaagatcgtg
cgcgacttgcaaagtgtcatcgggcgcgagaccaaagagcagctggctgaatttggcgta
aagcccgactatatcgtcgcctgcgtgggtggtggcagtaacgcgataggtattttcagc
gcatttttggacgatacggacgtgcatttgatcggcgttgaggcggcggggctgggagcg
gacacgccataccacgcagccacgctcacaaaggggcgcgagggcatcatccacggtatg
aaaaccatcgtcttgcaggatagctacggcatgatcgcccccgtgcatagtatctcggcg
gggcttgactacccgggtgtcggtccggagcactcgcacctgcatgacatcaaaagggcg
cattatgagggcgtgacggatgacgaatgtatcgaggctttgaagctcactagccgctta
gagggcatcatcccggcgatcgagagctcgcacgcgctggcgtatctagcgaaactctgc
cctacgctaagcggcaaaaaaacgatcgtcgtaaatgtctccggcagaggcgacaaggac
atgaacaccgtgatgggctacgagaaaggaaaaatttatggataa

DBGET integrated database retrieval system