KEGG   Corallococcus coralloides: COCOR_06655Help
Entry
COCOR_06655       CDS       T01780                                 

Gene name
celA
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccx  Corallococcus coralloides
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCOR_06655 (celA)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     COCOR_06655 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8367159..8368607)
Genome map
AA seq 482 aa AA seqDB search
MRTPRSVRRLSLSFLPLFALAACGPAEPVTPDAPALTAQEAALTELLTNGSFSSGSVAPW
WNNASTQSSVESGLWRVDVAANTANPWDAIVGQSGLTLTAGKTYTLAFTARASATITAQA
TVQQEVAPYTSTLTRSFTLDGTSRRFSFPFTSSLSTGQGQVTFQLGGRANAVTVRLDDIS
LTTESGTGSGPVAMTSGFYVDPNSNPAVWVRNNSGDGRASRINASIASKPMARWFGNWNG
NIAQDVSNFVAAADAADKLPVLVAYNIPGRDCGSHSGGGAGSADAYRAWISAFATAIGNR
PAVVIVEPDGVAQLDCLPNDTERATRLSLIRYASEQLRDRAPNTWTYLDGGNASWIAADT
MAQRLESAGVRNVRGFSLNVSNFYPTAQSTTYGNAVNAALNSRYGYTRQYVIDTSRNGNG
SNGEWCNPAGRKLGVTSQTGGGAEMLLWVKTPGDSDGQCGIAPGTPAGQFSPDIANRLID
GT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccctcgttccgtgcgtcggctgtcgctgtcgttcctcccgctgttcgcgctc
gcggcctgtggcccggccgagcccgtcactcctgacgctcccgcactcaccgcgcaggag
gcggcgctcaccgagctgctcaccaacggctccttcagctccggctcggtggcgccgtgg
tggaacaacgccagcacgcagtcgtccgtggagagcgggctgtggcgcgtggacgtggcg
gcgaacaccgccaacccgtgggacgccatcgtgggacagagcggcctgacgctcaccgcc
gggaagacatacacgctggccttcacggcccgggcctccgcgaccatcaccgcgcaggcc
accgtgcagcaggaggtggcgccgtacacgtccacgctcacgcggtccttcacgctggac
ggcacgtcgcggcgcttctcgttcccgttcacgtcctcgctgtccacgggccaggggcag
gtgacgttccagctgggcggccgcgccaacgccgtcaccgtgcggctggatgacatctcg
ctcaccacggagagcggcaccggctccggcccggtggcgatgacgagcggcttctacgtg
gaccccaactccaaccccgcggtgtgggtgcgcaacaacagcggtgacggccgcgcgtcg
cgcatcaacgcgtccatcgcctcgaagccgatggcgcgctggttcggcaactggaacggc
aacatcgcccaggatgtgtccaacttcgtggcggcggcggacgcggcggacaagctgccc
gtgctggtggcctacaacatccccggccgcgactgcggcagccactccggcggcggagcg
ggcagcgcggacgcgtaccgcgcctggatctccgcgttcgcgacggccatcggcaaccgg
ccggcggtggtcatcgtggagccggacggcgtcgcgcagctggactgcctgcccaacgac
acggagcgcgccacgcggttgagcctgatccgctacgcctccgagcagctgcgcgaccgc
gctcccaacacctggacgtacctggacggtggcaacgcgagctggatcgccgccgacacc
atggcgcagcggctggagtccgcgggcgtgcgcaacgtgcgcggcttctctctcaacgtc
tccaacttctaccccaccgcgcagtccaccacgtacggcaacgcggtgaacgccgcgctg
aacagccgctatggctacacgcggcagtacgtcatcgacaccagccgcaatggcaacggc
tccaacggcgagtggtgcaaccccgctggccgcaagctgggcgtgacgtcccagacgggc
ggcggcgcggagatgctcctgtgggtgaagacgccgggagactcggatggccagtgcggc
atcgccccgggcacgcccgccggacagttcagcccggacatcgcgaaccgcctcatcgac
ggcacctga

DBGET integrated database retrieval system