KEGG   Corallococcus coralloides: COCOR_06655Help
Entry
COCOR_06655       CDS       T01780                                 

Gene name
celA
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccx  Corallococcus coralloides
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8367159..8368607)
Genome map
AA seq 482 aa AA seqDB search
MRTPRSVRRLSLSFLPLFALAACGPAEPVTPDAPALTAQEAALTELLTNGSFSSGSVAPW
WNNASTQSSVESGLWRVDVAANTANPWDAIVGQSGLTLTAGKTYTLAFTARASATITAQA
TVQQEVAPYTSTLTRSFTLDGTSRRFSFPFTSSLSTGQGQVTFQLGGRANAVTVRLDDIS
LTTESGTGSGPVAMTSGFYVDPNSNPAVWVRNNSGDGRASRINASIASKPMARWFGNWNG
NIAQDVSNFVAAADAADKLPVLVAYNIPGRDCGSHSGGGAGSADAYRAWISAFATAIGNR
PAVVIVEPDGVAQLDCLPNDTERATRLSLIRYASEQLRDRAPNTWTYLDGGNASWIAADT
MAQRLESAGVRNVRGFSLNVSNFYPTAQSTTYGNAVNAALNSRYGYTRQYVIDTSRNGNG
SNGEWCNPAGRKLGVTSQTGGGAEMLLWVKTPGDSDGQCGIAPGTPAGQFSPDIANRLID
GT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccctcgttccgtgcgtcggctgtcgctgtcgttcctcccgctgttcgcgctc
gcggcctgtggcccggccgagcccgtcactcctgacgctcccgcactcaccgcgcaggag
gcggcgctcaccgagctgctcaccaacggctccttcagctccggctcggtggcgccgtgg
tggaacaacgccagcacgcagtcgtccgtggagagcgggctgtggcgcgtggacgtggcg
gcgaacaccgccaacccgtgggacgccatcgtgggacagagcggcctgacgctcaccgcc
gggaagacatacacgctggccttcacggcccgggcctccgcgaccatcaccgcgcaggcc
accgtgcagcaggaggtggcgccgtacacgtccacgctcacgcggtccttcacgctggac
ggcacgtcgcggcgcttctcgttcccgttcacgtcctcgctgtccacgggccaggggcag
gtgacgttccagctgggcggccgcgccaacgccgtcaccgtgcggctggatgacatctcg
ctcaccacggagagcggcaccggctccggcccggtggcgatgacgagcggcttctacgtg
gaccccaactccaaccccgcggtgtgggtgcgcaacaacagcggtgacggccgcgcgtcg
cgcatcaacgcgtccatcgcctcgaagccgatggcgcgctggttcggcaactggaacggc
aacatcgcccaggatgtgtccaacttcgtggcggcggcggacgcggcggacaagctgccc
gtgctggtggcctacaacatccccggccgcgactgcggcagccactccggcggcggagcg
ggcagcgcggacgcgtaccgcgcctggatctccgcgttcgcgacggccatcggcaaccgg
ccggcggtggtcatcgtggagccggacggcgtcgcgcagctggactgcctgcccaacgac
acggagcgcgccacgcggttgagcctgatccgctacgcctccgagcagctgcgcgaccgc
gctcccaacacctggacgtacctggacggtggcaacgcgagctggatcgccgccgacacc
atggcgcagcggctggagtccgcgggcgtgcgcaacgtgcgcggcttctctctcaacgtc
tccaacttctaccccaccgcgcagtccaccacgtacggcaacgcggtgaacgccgcgctg
aacagccgctatggctacacgcggcagtacgtcatcgacaccagccgcaatggcaacggc
tccaacggcgagtggtgcaaccccgctggccgcaagctgggcgtgacgtcccagacgggc
ggcggcgcggagatgctcctgtgggtgaagacgccgggagactcggatggccagtgcggc
atcgccccgggcacgcccgccggacagttcagcccggacatcgcgaaccgcctcatcgac
ggcacctga

DBGET integrated database retrieval system