KEGG   Corynebacterium diphtheriae HC04: CDHC04_0782Help
Entry
CDHC04_0782       CDS       T01696                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDHC04_0782 (galU)
   00052 Galactose metabolism
    CDHC04_0782 (galU)
   00500 Starch and sucrose metabolism
    CDHC04_0782 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC04_0782 (galU)
Enzymes [BR:cda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CDHC04_0782 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807004..807924
Genome map
AA seq 306 aa AA seqDB search
MTSPKSGNSCAVRTVIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLGATR
LAVITAPKKQEVLDHFNRFPELEATLESRGKKDQLAKVVRAAELIQPVSVVQETPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPMGVVEKMVEVRRQLGGSVLCAFDVPREDVYNYG
VFDIEECDYDGPYQVKSVKGMVEKPAVEDAPSTFVATGRYLLDRAIFDALRRITPGAGGE
LQLTDAIALLINEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPTYGPHLKKVLRTI
LEEHGA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccaagagtggtaattcgtgtgccgtcagaaccgtgatcgtcccagctgct
ggtttgggtacacggtttctccctgccacaaagaccgtccctaaggagctccttcctgtc
gtcgatacgccaggtatcgagctgattgctgaggaggccgcgcagttgggggcaacgcgt
ttggctgtgattacggcgccgaaaaagcaggaagtgttggatcacttcaacaggttccca
gagctggaagcaacgttggaaagtcgtggcaagaaggatcagctggcaaaggttgtgcgt
gctgctgaactgattcagccggtttctgtggttcaagagactccgcttggtctggggcat
gcagtggggttggcggaaagcgtgttggatgacgatgaagacgtcgtagctgtcatgctt
ccggatgacttggtgctgcccatgggcgttgtggaaaagatggtggaggtgcgtcgccag
ctgggaggctctgtgctgtgcgctttcgatgttcctcgtgaagatgtgtataactacggc
gtctttgatattgaggagtgcgattacgacggcccttaccaagtcaagagtgtgaaaggc
atggtggaaaagccagccgtagaagacgcaccttcgacgtttgttgcaacaggtcgttat
cttttggatcgtgcgatttttgatgcgcttcgccgtatcacccctggtgcgggcggtgag
ctgcagcttactgatgctattgcgttgcttattaatgaggggcatccagtccacatcttg
gttcacgatggaaagcgccatgatttgggaaatcctggtggttatatcccagcggtggtg
gattttggtttgtcggatccgacgtatggcccacatttgaagaaggtcctgcgtaccatt
ttggaagagcacggcgcttaa

DBGET integrated database retrieval system