KEGG   Clostridium difficile 630: CD630_21180Help
Entry
CD630_21180       CDS       T00487                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cdf  Clostridium difficile 630
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdf00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cdf00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2451653..2453134
Genome map
AA seq 493 aa AA seqDB search
MYYSSTRGTEEKVTASQAIIKGISNDGGLYVPSEFPNVKNELINLVNLTYSQIAFFVLSK
FLCDFTEDEIKNCIENAYDEKFDCSSIAPLNKVNDTYFLELYHGPTLAFKDMALTIMPHL
LKTSIKKDNLEKDVVILTATSGDTGKAALEGFKDIDKIKIIVFFPEDGVSPVQKLQMKTQ
TGKNTYVVGIKGNFDDAQSGVKKIFSDKEFNQKLLDNNYILSSANSINIGRLLPQVAYYF
YSYMKLVSNSDINLNDKINFVVPTGNFGNILAGYYAKQMGLPINKLICASNDNNVLYDFF
KTGVYDKNRTLKLTTSPSMDILISSNLERLLFEISNRNTDIVNKLLSDLSDKGVYKISDD
MEKNLASFYGEYSNEEEVKSTINNVFKNYNYLIDTHTAVAYNCYEKYKKETSDNTKTVIV
STASPFKFSEDVLKSIDCDFKDLDDFAIIDRLSSISKIDIPKPIKNLKNAEILHKDIYEK
DELKLAIKKFLKV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtattattcaagtacgagaggcaccgaagaaaaagtaactgcatcacaagcaataata
aaaggaatatcaaatgatggtggtctttatgttccaagtgaatttcccaatgtaaaaaat
gaacttataaatttagtaaatttaacgtattctcagatagcattttttgtacttagtaaa
tttttatgtgattttactgaagatgaaattaaaaattgtatagaaaatgcatatgatgaa
aagtttgattgtagtagtatagctccattaaataaagtaaatgatacttatttcttagaa
ctatatcacggtccaactttagcatttaaagatatggcacttactataatgcctcatctt
cttaaaacatctataaagaaagataatttagagaaagatgttgtgattcttactgctaca
tctggagatacaggtaaagctgcacttgagggatttaaagatatagataaaataaagata
attgtattcttcccagaagatggtgtaagcccagtacaaaaacttcaaatgaaaactcaa
actggaaaaaatacatatgtagttggtataaaaggaaattttgatgatgcacaatcaggt
gtaaagaagattttttctgataaagaatttaatcaaaaactattggataataattatata
ttatcttctgcaaattcaattaatataggaagacttcttccacaagttgcatactatttt
tattcatatatgaaattagttagcaatagtgatataaatttaaatgataaaataaatttt
gttgtcccaactggtaattttggtaatattctagctggatattatgccaaacaaatgggt
cttccaataaacaaattgatatgtgcatcaaatgataataatgttctttatgatttcttt
aaaactggtgtatatgataaaaatagaacattgaaattaactacttctccttctatggat
atattaatttcaagtaatttagaacgattactgtttgaaatatcaaatagaaatactgat
attgtaaataagcttttatcagaccttagtgataaaggagtctacaaaataagtgatgat
atggaaaaaaatttagcctcattctatggagaatattcaaatgaagaagaagttaaaagc
acgataaacaatgtgtttaaaaattataattatttgatagatactcatactgctgttgca
tacaattgttatgaaaaatataaaaaagaaacttctgataacacaaaaactgttattgta
agtactgcaagtccattcaagttttctgaagatgttctaaagtctatagattgtgatttt
aaagaccttgatgactttgctataattgatagattatcaagtatttctaaaatagatatt
ccaaaacctattaaaaatcttaaaaatgcagaaatactacataaagatatttatgaaaaa
gatgaattaaaactagctataaaaaaattcttaaaggtatag

DBGET integrated database retrieval system