KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1533Help
Entry
CDB402_1533       CDS       T01688                                 

Gene name
ltsA
Definition
putative asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cdh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1672057..1673979
Genome map
AA seq 640 aa AA seqDB search
MCGLLGMLSSTGQASKYAAAIESALPCMHHRGPDEAGTWHDDHAVFGFNRLSIIDLEHSH
QPLRWGPEGEPDRYAMTFNGEIYNYVELRKKLQDLGYTFNTSGDGETIAVGFHHWGADVV
LHLRGMFGIAIWDTKEQRLFLARDQFGIKPLYFATTEAGTVFASEKKCILGMADAIGLDL
GLDQRAIEHYIDLQYVPEPESLHQHIRRLESGCFAFVSVGGNVEQTRYFRPQFPAQEFPK
DKEQDLFDRIAKALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFE
REGYSEVDVAAESAAAIGVEHIVKIVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGKVAEVFPDGMRGKSL
LQRGSMTMEERYYGNARSFNFDQMKRVIPWAKKEWDHREVTAPIYAQSEHMDPVARMQHL
DLFTWMRGDILVKADKINMAHSLELRVPFLDKEVFEVAETIPYDLKIANGTTKYALRKAM
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTINESMTDQYFDKAAVLAMLNEHKN
GVSDHSRRLWTVLAFMIWHGIFVEHRIDPGIEKRDYPVYL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggacttctaggcatgctctccagcacaggacaggccagtaagtatgcagctgct
atagaaagtgctttgccgtgcatgcaccaccgaggccctgacgaagcaggtacttggcat
gacgaccatgcagtttttggctttaatcgcctatcgatcatcgatctcgagcattctcac
cagcccttgcgatgggggcctgaaggcgagcccgaccgctatgccatgacttttaatggc
gagatctacaactatgtagagctacgaaaaaaacttcaagacctcggctacacctttaac
acttcaggcgacggcgaaactattgctgtcggtttccaccactggggtgcagatgtagtg
cttcacttgcgcggaatgtttggcatagccatttgggacaccaaggaacaacgtcttttc
ttggcccgcgatcaatttggcatcaagccgttgtactttgctactaccgaagctggcacc
gttttcgcctcggagaaaaagtgcatcttgggtatggcagatgctattggtctagattta
gggcttgaccaacgtgccatcgaacactacatcgatcttcaatacgttccagagcctgaa
agtcttcatcagcacattcgacgcctggagtctggctgctttgctttcgtttctgtggga
ggcaatgtcgagcagactcgttacttccgtcctcagttccccgcacaagaattcccaaag
gacaaggaacaggatctcttcgatcgaatcgccaaggccctagaagatagcgtcgaaaag
cacatgcgtgccgacgtcactgtcggttctttcctgtctggcggcatcgactccactgcg
attgcaactttggcaaaacgccataatccgaatctgttgacattcactacaggatttgaa
cgcgaaggatattcggaagtcgatgtggctgcagaatccgctgctgccattggagtagaa
catatcgttaagattgtctctcccgaggaatatgccaatgccattcctcaaatcatgtgg
tacttggatgatccagtagctgatccctccctagtcccactattcttcgttgctcaagaa
gcccgcaagcatgtcaaagtggtgttgtcaggcgaaggagcagacgaactatttggtggt
tacaccatttacaaagagccgctttctcttgctccatttgaaaagattccttccccgcta
cgtcgcggtcttggcaaagtagccgaagttttccctgacggaatgcgtggtaaatccttg
ctccaacgcggttcgatgacgatggaagagcgttattacggaaatgctcgttccttcaat
tttgatcaaatgaagcgcgttatcccatgggccaagaaggaatgggatcaccgcgaagtc
accgcaccgatctacgcccagtctgagcacatggaccccgttgcgcgaatgcagcatttg
gaccttttcacgtggatgcgcggcgatatcctcgtcaaggccgacaagatcaacatggct
cactccttggagcttcgcgtcccgttcttggataaggaagtatttgaggttgctgaaacc
attccttatgacctcaagattgctaacggaacgaccaaatatgcgttgcgtaaggccatg
gaacaaatcgttccgccgcacgtgctacaccgcaagaaactcggattcccagtgcctatg
cgccactggctagctggcgatgagctgttcggttgggctcaagacaccattaatgagtcg
atgaccgaccaatactttgacaaggcagcagtcttagcaatgctcaatgagcacaagaat
ggtgtatctgatcattcccgcaggctatggacagtccttgcctttatgatttggcacgga
attttcgtcgagcaccgcattgatccaggcatcgagaaacgcgattatcctgtgtaccta
tag

DBGET integrated database retrieval system