KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0631Help
Entry
DIP0631           CDS       T00151                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DIP0631 (icd)
   01210 2-Oxocarboxylic acid metabolism
    DIP0631 (icd)
   01230 Biosynthesis of amino acids
    DIP0631 (icd)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DIP0631 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DIP0631 (icd)
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DIP0631 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(600526..602739)
Genome map
AA seq 737 aa AA seqDB search
MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGRILAQFPDYLNEDQKV
DDALAELGELAKTPEANIIKLPNISASVPQLKAAIAELKAQGFALPEYPDSPATDEEKDV
RARYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKNPHKMGVWSADSKTNVATMDANDFR
HNEKSVIMPAADTLTIKHIATDGTETILKDGLKVLEGEVIDGTFLSAKALDAFLTEQVQR
AKNENVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFATYGDQLNAAGLNGENGLAAIYS
GLDALDNGAEIKAAFDAALEAGADVAMVNSAKGITNLHVPSDVIIDASMPAMIRTAGHMW
NKDDQEQDTLAVIPDSSYAGVYQVVIEDCKKNGAFDPTTMGTVPNVGLMAQKAEEYGSHD
KTFKIAADGKVVVVNAAGEALIEHDVEAGDIWRACQAKDAPIQDWVKLAVTRSRLSGMPA
VFWLDPKRAHDRSLITLVKKYLADHDTEGLDIQIMSPTEATQFSIDRIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEENHLRWDSL
GEFLALAESLRHFANTEGNTKAGVLADALDRATETLLNEGYSPSRKAGEIDNRGSHFFLT
LNWAKELAAQTDDTALAETFAPVAAQLEDNKDTIAAALIDVQGTPVDLGGYYQPDDAKTA
AVMRPVAEFNDIIDALK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcatttacacccgcaccgacgaagcaccgttgcttgctacgtactccctg
aagccagtcgtcgaagccttcgcttccaccgccggcatcgaggttgaaactcgcgatatt
tccctcgcgggccgtattcttgcccagttccctgactatctcaacgaggatcagaaggtc
gacgacgcacttgcagagctcggcgagctggccaagaccccagaagcaaacatcattaag
cttcctaatatttcggcatccgtgccacagctcaaagcagccattgcagagctcaaagca
cagggcttcgcacttccggagtacccagactcccccgccaccgatgaagaaaaagacgtc
cgtgcgcgctacgatgccgtcaagggctctgccgtcaacccagtacttcgtgagggcaac
tccgaccgccgcgcccccatcgcggtgaagaacttcgccaagaagaacccccacaagatg
ggcgtttggtccgctgactccaagaccaacgtagccaccatggacgcaaacgacttccgc
cacaacgagaagtccgtcatcatgcctgctgcagacaccctcaccatcaagcacatcgcc
accgacggcaccgaaaccatcctcaaagatggcctcaaggttctcgaaggtgaagtcatc
gacggcaccttcctgtccgccaaggctctcgacgccttcctcaccgagcaggtacagcgt
gccaagaatgagaacgttttgttctccgcccacctcaaggcaaccatgatgaaggtatcc
gaccccatcatcttcggacacgtcgtccgcgcctactttgccgacgtctttgccacctac
ggtgaccagctcaacgcagccggcctcaacggcgaaaacggccttgccgcaatctacagc
ggcctcgacgccctcgacaatggcgccgagatcaaggcagctttcgacgccgctctcgaa
gcaggtgccgacgttgccatggtcaactccgccaagggaatcaccaacctccatgtccct
tccgatgtgatcatcgacgcctccatgccagccatgatccgcaccgcaggccacatgtgg
aacaaggacgatcaggaacaagataccctagcagttatcccagactcctcctacgcaggc
gtctaccaagtcgtcattgaagactgcaagaagaacggcgccttcgatcccaccaccatg
ggcaccgtgcccaacgtcggactcatggcacaaaaagccgaagagtacggctcccacgat
aagaccttcaagattgcagcagacggtaaggtagtcgtcgtcaatgccgcaggcgaagca
ctcatcgagcacgacgtagaagcaggcgacatctggcgcgcatgccaggccaaggatgcc
ccaatccaagactgggtcaagctcgccgtcacccgctcccgactctccggcatgccagca
gtattctggctcgacccaaagcgtgcccacgaccgcagcctgatcaccctagtaaagaag
tacctcgctgatcacgacaccgagggcctcgacatccagatcatgagccccaccgaggca
actcagttctccatcgatcgcatccgccgcggcgaagacaccatctccgtcaccggcaac
gtgctgcgcgactacaacaccgacctattcccaatcctcgagctcggcacctccgccaag
atgctctccgtcgtgccactcatggcaggcggcggactcttcgaaactggcgccggcgga
tctgcaccaaagcacgtccaacagctcgttgaagaaaaccacctgcgctgggactccctc
ggcgaattcctcgccctagcagaatccctgcgccacttcgccaacaccgaaggcaacacc
aaggcaggcgtacttgccgacgccctcgatcgagcaaccgaaaccctcctcaacgagggc
tactccccatcgcgcaaagctggcgaaatcgacaaccgtggctcgcacttcttcctcacc
ctcaactgggccaaggaactagcagcccaaaccgacgacaccgcgctagccgaaaccttc
gcacctgtcgccgcacagctcgaggacaacaaagacaccatcgcagcagcgcttatcgac
gtccaaggcacaccagtagacctcggcggctactaccagcctgacgacgccaagaccgca
gcagtcatgcgccccgtcgcagaattcaatgacatcatcgatgcgctgaagtaa

DBGET integrated database retrieval system