KEGG   Corynebacterium diphtheriae C7: CDC7B_0608Help
Entry
CDC7B_0608        CDS       T01699                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDC7B_0608 (rbsK)
Enzymes [BR:cds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CDC7B_0608 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(612485..613390)
Genome map
AA seq 301 aa AA seqDB search
MSSSMTVVGSINADVSIQVARHPSPGETLLGHDSTISPGGKGANQAVAAALQGATVSFVG
AVGNDTYADHALKILRSSGVNLDAVEAIDGNTGVAYIQVSDDGENSIIVIPGANAHVTAD
YVEHHRKPIEDADIVLLQGEIPADGFSAAVQAARGTVVVNLAPVIDVDRDCLLRADPLMA
NEHEAALILEQLGAPVTSEDPHVLIEALRSQGFASVVLTLGGHGALVADASGVTPIATPY
VTAVDTTGAGDAFAGAFVARRLQGDSLIDAATFAARVGAFSVQGRGAQTSYPSDSDTLPA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcatctatgactgttgttggttcgatcaacgctgacgtcagcatccaagtagca
cgacatcccagcccaggcgaaaccctccttggccacgactccaccatcagcccaggcggc
aaaggcgcaaaccaagccgttgccgccgcgctgcaaggtgcaactgtgtcgttcgtaggc
gcggtaggaaacgacacctatgccgaccacgcactgaaaatcctgcgatcttccggcgtg
aacttagacgcggtcgaagcaatcgacggcaataccggcgttgcttatattcaagtttct
gatgacggcgaaaacagcatcatcgttatccccggcgcgaacgcgcatgtcaccgcggac
tacgtggaacaccatcgtaagcccatcgaggatgccgacatcgtgctcttacagggtgag
attcccgcggatggttttagcgccgcagtgcaggcagctcgaggcaccgtggtagtcaat
cttgcgcctgtgattgatgtcgatcgtgactgcctcctgcgcgcggatccgttgatggct
aatgagcatgaggcggcgttgattctagagcaactcggcgctcctgtaaccagcgaggat
ccccacgttctcatcgaagcgttgcgttctcaaggttttgcctccgtggtgttgaccctt
ggtggacatggcgcgctggtcgccgatgcttctggtgtgacaccgattgccaccccatac
gtcacagcagtagacaccacgggtgctggtgacgcattcgcaggggctttcgtggcacgt
cgtttgcaaggagactcgcttatcgacgccgccacgttcgcagcccgtgtcggagcgttc
tccgttcagggtcgcggggcgcaaacttcttatccttctgactccgatacgctgcccgcg
gtgtag

DBGET integrated database retrieval system