KEGG   Caenorhabditis elegans (nematode): CELE_B0218.3Help
Entry
CELE_B0218.3      CDS       T00019                                 

Gene name
pmk-1
Definition
Protein PMK-1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_B0218.3 (pmk-1)
   04068 FoxO signaling pathway
    CELE_B0218.3 (pmk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_B0218.3 (pmk-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CELE_B0218.3 (pmk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(8148806..8148954,8148999..8149564,8149932..8150296,8150688..8150741)
Genome map
AA seq 377 aa AA seqDB search
MFPQTTMDHILHPTPREGYYVVELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTR
VAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLM
GADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDF
GLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHI
DQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKML
HLDPDRRPTAKEAMEHEYLAAYHDETDEPIAEEMDLNDDVRADTIDEWKKIIWEEISDFQ
KNVAFADEEEDEEKMES
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtttccacagacaacaatggatcatatacttcatccgactccacgagaaggatactat
gtcgttgagcttaatcgaagtgtctgggttgttccaaattattatattaacttgactcca
attggtaccggagcatatggaactgtttgtgctgctgaatgtactcgctcggggactcgc
gtcgcaatcaaaaaattcaatcgtccatttcaatcaataattcatgcccgtcgtacatat
cgtgaactccgacttcttcgttgtatgtgtcatgaaaatataattgatctacttgatgtc
ttcactccaaatgagaatgtaaatgatatcgaggatgtgtattttgtatcaatgttgatg
ggagctgatctatcaaatattctcaaaattcagcgactcaacgatgaccacattcaattc
ttagtctatcaaattcttcgtggactcaaatacattcattctgcagatattattcatcga
gatcttaaaccatcaaatattgctgttaatgaggattgtgaattgaaaattcttgatttt
ggattggcacgtcaaactgattctgaaatgactggatacgtggcaacaagatggtacaga
gctccagagattatgctcaattggatgcattacacgcagactgttgatgtatggtcagtt
gggtgtattcttgcagaacttatcactggaaaaacattgttccctggatctgatcacatc
gatcaattgactcgtatcatgtcagtaactggaacaccagatgaagaattccttaaaaag
atctcatcagaagaagctcgtaattacattcgaaatcttccaaaaatgactcgccgtgat
ttcaaacgtctgtttgctcaagcaactcctcaagcaatcgatctccttgaaaagatgctt
caccttgatccagatcgtcgtccaactgcaaaagaagctatggagcatgaatatctggct
gcttatcacgatgaaactgatgagccaattgcagaagaaatggatttgaatgatgatgta
agggcagatacaattgatgaatggaagaaaattatttgggaagagatcagtgatttccag
aaaaacgtggcatttgctgacgaagaggaagatgaggagaaaatggaatcgtag

DBGET integrated database retrieval system