KEGG   Caenorhabditis elegans (nematode): CELE_C24F3.3Help
Entry
CELE_C24F3.3      CDS       T00019                                 

Gene name
nas-12
Definition
Protein NAS-12
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_C24F3.3 (nas-12)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_C24F3.3 (nas-12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(10224032..10224182,10224225..10224372,10224726..10225018,10225075..10225385,10225494..10225592,10226141..10226293)
Genome map
AA seq 384 aa AA seqDB search
MLYIPQFSIYFCLGYLLLFCKISNAVKQSWEINQELITEANKEHTVFGDMLLTPAQLIRY
ENSKDSDLSIRGVSIKGSSMNRWSNNIVPYVISPQYSPAQKQILVSSLRYFERVSCFKFV
ERTTQNDYLFIVPLDGCYSYVGKIGGRQTLSLAADCIADYIIWHEMMHAIGFEHEHQRPD
RDSFIRVDYANVIPGQMINFDKLKTSHVEYPDIYDFKSIMHYDGYAFGRVDTARRVRLAT
MTPLKPGVTLEDNMKFTATDIEKLNRLGQCGARGGQYSNQGVVASTCQDVATAVSCEGNR
RRGMCKNPFYKQMMIKSCQKTCRLCSYTRMIDEDDDLTPNTTVKSVKCEDKHPRCDIYSH
NGFCTLPFYDDVRYQLCAKTCNLC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttatacatacctcaattttctatatatttttgtctagggtatctactacttttttgc
aaaatttcaaatgcagtgaaacagtcatgggaaattaatcaagagctaataacagaagca
aacaaagaacatactgtatttggtgatatgctcctcacaccagcccaattgattcgatat
gaaaattccaaagattccgatttgtcaattaggggtgtatcaataaaaggaagttcaatg
aatcggtggagtaacaatatcgttccatatgtgatctcaccacaatactctcctgcacag
aaacaaatcctggtttcttctcttcgatacttcgaacgagtatcttgtttcaaattcgtc
gagcgtacaacacaaaacgattacttgttcattgttccactagacgggtgttattcgtat
gttgggaaaattggtggtagacagactttgtcattggcagctgattgtattgctgattat
atcatttggcatgaaatgatgcatgcaataggattcgaacatgaacatcagagacccgat
agagattcctttattcgagttgattatgcaaatgttattcctggacagatgataaacttt
gataaactgaaaacttcccatgtcgagtaccctgacatttacgatttcaaatcaattatg
cattatgatggttacgcatttggaagagttgacactgccagacgtgttagattagcaaca
atgactccattaaaacccggtgtaactttggaagacaatatgaaattcactgctacagat
attgaaaaactgaataggctcggtcaatgtggtgcccgtggcggacagtacagtaaccaa
ggagttgtcgcctcaacttgccaagatgttgcaaccgctgttagttgtgagggaaataga
aggcgtggaatgtgcaaaaatccgttctacaaacaaatgatgatcaagtcttgccagaaa
acatgcagactatgttcgtacacaaggatgattgatgaagatgacgatctaactccaaat
actacagtaaaatctgtaaagtgcgaggacaaacacccacgatgtgatatttactcacac
aatggtttctgcactcttccattttacgatgatgtacgatatcagttatgtgctaaaacg
tgtaatttatgttaa

DBGET integrated database retrieval system