KEGG   Caenorhabditis elegans (nematode): CELE_Y6B3B.5Help
Entry
CELE_Y6B3B.5      CDS       T00019                                 

Definition
Protein Y6B3B.5, isoform B
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_Y6B3B.5
  Energy metabolism
   00920 Sulfur metabolism
    CELE_Y6B3B.5
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_Y6B3B.5
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CELE_Y6B3B.5
    3.1.3.25  inositol-phosphate phosphatase
     CELE_Y6B3B.5
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(13751324..13751426,13752304..13752412,13753539..13753751,13754947..13755042,13755109..13755289,13755335..13755453,13755875..13755986,13756035..13756130,13756195..13756212))
Genome map
AA seq 348 aa AA seqDB search
MQYTPIEPKMQVKLHPKNTFTIIMVVGFLYLAYLIFFESGDGMPEIDVDLKDVISYAVLA
IEMGGHAVMKVNEEKNLNAAAKGLTDEGKEELLTRADLISNHLILDILQRFPQLQIVSEE
KKSEFSEREIEPYRLDNYAVWQSVKEILDKIPSRRLQLSDVRVFVDPLDATQEFTEGLTE
YVTVMACIVLDAEPIFGAIYRPFFNETIFGLQGFGVITSDGVRLNPIEDSKTAKKVVVSR
SHAGKVKEIVEKVYGDKMNIEPAGGSGYKTLRLVNGTAELYLHTTAIKKWDTCAGDAILR
TMGGAMLDLEGQPLRYSSADPLLNKKGLLATVRNPYSYLNKFQGIQIL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacaccccgattgagccaaaaatgcaggtcaaactccacccgaagaacactttt
acaataattatggtcgtaggatttctctacttggcttatttaatatttttcgagagtgga
gatggaatgccagaaatcgatgtagatttaaaggatgtgatcagctacgccgtacttgca
attgagatgggcggtcacgcagtaatgaaggttaacgaggagaaaaacctaaacgccgct
gcaaagggtctaacggacgaaggaaaagaggagcttctaacaagagcagatttaatctca
aatcatctaattctggatattttacaacgatttccgcagttacagatagtttctgaggaa
aaaaagtcggaattctccgaaagagagatcgaaccctatcgattggataattacgcggtt
tggcaatcggtgaaggagattctcgacaaaattcccagtaggagacttcaactttctgat
gttcgagttttcgtggatccattagatgctactcaggagtttacagaaggactcaccgaa
tatgtcaccgtaatggcatgtattgtattggacgcggagcccattttcggagcaatttac
cgcccgtttttcaatgaaaccattttcggcctacaaggttttggagtaataacatcagat
ggagtacgactaaatccaattgaagactcaaaaaccgccaaaaaagtggtcgtatcgaga
agtcatgcgggaaaagtgaaggaaattgtagaaaaagtgtatggagacaaaatgaacatt
gagccggcaggtggcagtggttataagacgcttcgacttgttaatggaactgctgaactc
taccttcacacaactgcaatcaaaaaatgggatacctgtgcgggagacgcaattctacga
acaatgggcggagctatgttggatttagagggacaacctctgagatactcctctgctgac
ccacttctgaacaaaaaaggactcctcgcaaccgtccgaaatccttattcatatttgaac
aagttccaaggaattcagattttataa

DBGET integrated database retrieval system