KEGG   Crinalium epipsammum: Cri9333_4298Help
Entry
Cri9333_4298      CDS       T02373                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cep  Crinalium epipsammum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cri9333_4298
Enzymes [BR:cep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cri9333_4298
Peptidases [BR:cep01002]
 Cysteine Peptidases
  Family C44
   Cri9333_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4846456..4848441)
Genome map
AA seq 661 aa AA seqDB search
MSAIAGIYYLDNRQVDRADLVKMTDILAHRGPDGSNVWTKGAIGIGHRMLWTTPESLLET
LPLVNETGELVITADARIDNRDELIEALELTQRPAEKITDTELILAAYERWGEECPKHLL
GDFAFAIWDGRKQELFCARDHFGVKPFYYYCSDKTFIFATEIKAIFCLSEVPNQINEIRI
ADYLVSNFDDKTITSYQDILRLPPAHRMIVSHIGKQLEPYWCLDPTREIRLTSNEEYAEK
FLELLTEAVRCRLRSAFPIGSALSGGLDSSFISCIARDILNEDGTKKLHTFSAIFDKLPQ
CDERPYINAVLNQGGFEPHYIYGDESSPLENIKDIFWHQDEAFFAPNLSMTWSIQETIQK
QGVRIQLEGFDGDSTVSYGFGYLHELAQERRWLALAIQIRGLARSYNESAGKLLWPYLWA
YGLKPKISNSPVFNLGQRLWRVLLRGLFKGSSQSTEQPTWSKIFNPEFIERIGFSERYRT
LQLAQRDARTARKEHYHTLNNGLLPFALEVLDKVSGAYGIETRYPFWDKRLVEFCLALPA
EQKLDQGWSRIVMRRAMTAILPAKVQWRRDKSNFLPNLCHGLLNRDRECLNDLILGDPNS
LEKYVNITALHEIYHQFISQKSLAAPQDIYTIWKVTSLTLWLQYKESKQLNKKEVKGVIT
M
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgatcgcgggaatctactaccttgataatagacaagtagaccgcgccgatctg
gtcaagatgaccgatattctcgctcatcgaggacctgatggctcaaatgtgtggactaag
ggagcgatcggtatagggcatcgaatgctttggacaactccagaatcactgctggaaaca
cttcctttggttaacgaaactggcgagttagttatcacagcagatgcccgaattgataat
cgagatgaattaattgaagctttagaacttacacagcgccctgctgaaaaaattacagat
actgaattaatattagctgcttacgaacgatggggtgaagaatgcccaaaacatctttta
ggtgattttgcctttgcaatttgggatggacgcaagcaagaactcttctgtgctagagac
cattttggggttaaaccattttattattactgctctgataaaacctttatttttgctaca
gaaataaaagctatattttgcctatctgaagttcccaatcaaatcaacgagataagaatt
gccgattatttagtatcaaattttgatgacaaaacgataacttcttaccaagatattcta
cggcttcctcctgcccataggatgatagtaagccacataggtaaacagttagaaccttat
tggtgtctcgatccaactcgtgaaatccgtttaacctccaacgaagaatatgcagaaaag
ttcttagaattattaacggaggcagtaaggtgtcggcttcgtagcgcttttcctataggg
tcagcattgagcggtgggttagactcttcttttattagttgtatagcaagagatattctt
aatgaggatggaacaaaaaagttacacactttctcagcaatctttgataaactacctcag
tgtgacgagcgtccttacattaatgcagttttaaatcaaggtggtttcgagccgcactat
atttatggagatgaaagtagtccactagagaatataaaagatattttttggcatcaggac
gaagcattttttgcccctaatttatctatgacttggagtatccaagaaaccatacaaaag
cagggcgttcgtattcagttagaagggtttgatggtgatagcaccgtttcttacggtttc
ggatatttacatgaactcgcacaagaaagacgctggttagctttagcaatacaaatcaga
gggctagcaagaagttacaacgaatcagctgggaaattactatggccttatttatgggca
tacgggttaaaaccaaaaatttctaattctccagttttcaacctagggcagcgactgtgg
cgagtgctactccggggtcttttcaagggaagctctcaatctactgagcaacctacctgg
agtaaaatttttaaccctgaattcattgaacggattggtttttcagagcgttaccgtaca
ctgcaactcgctcaacgtgatgctcgaactgcaaggaaagagcactaccataccctaaat
aatggccttctaccttttgcgcttgaagtattggacaaggtttctggagcatacggtatt
gaaacccgttatcctttttgggacaagcggttggtagagttttgtctggctttacctgcc
gagcagaaacttgatcaagggtggagcagaattgtgatgcgccgtgctatgactgctatt
cttcctgccaaagtgcagtggcggcgtgacaaatcgaatttccttccaaatctatgccac
ggtttactcaatcgagatcgagaatgcctaaatgatctgattttaggcgatccaaactcg
ctcgaaaagtatgtaaatattactgccttgcacgagatttatcatcaatttatctctcaa
aaatctctagctgcaccgcaggatatatacacaatttggaaggttacatctttgactctg
tggttgcaatataaagagtcaaaacagcttaataagaaagaagtaaagggggtgataact
atgtaa

DBGET integrated database retrieval system