KEGG   Canis familiaris (dog): 403736Help
Entry
403736            CDS       T01007                                 

Gene name
ALPP, ALPI
Definition
alkaline phosphatase, placental
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cfa00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 644 aa AA seqDB search
MLLTHRGCAPWSPPHPGEAAGIIPCGHTCLFQDPCPEACSATPCHIPSASGLRVTGQGRG
QGGHRGQWEGHGDFYSQGQSPAPTKGPLAGTAAGTLALAPPGSQPATVLALPRPCHPTAM
QGARVLLLLLLLGLRPRLALGIIPAEEEDPAFWNRQAAQALDAAKKLQPIQTAAKNLILF
LGDGMGVPTVTATRILKGQINDNLGPETPLAMDQFPYLALSKTYNVDRQVPDSAGTATAY
LCGVKANYQTIGVSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGT
YAHVVNRNWYSDANMPAKALEDGCQDIAQQLISNMEIDVILGGGRKYMFPKGTPDPEYPT
DAKQNGIRLDGRNLVQEWQAKYQGARYVWNRTALIQASQDASVTHLMGLFEPGDTKYDVH
RDGIQDPSLMEMTEAALRLLSRNPKGFYLFVEGGRIDHGHHDGTAYLALTEAVMFDSAID
KAGQLTSERDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSMAKDNKTYTSILYGNGPGF
ALSGVPRPNVSDAESRDPAYKPQAAVPLDSETHGGEDVAVFARGPQAHLVHGVQEQSFVA
HVMAFAACLEPYADCNLQPSAAPTPTPQLMLQLLTGALLLALLA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgacccacagggggtgtgccccctggtccccaccccaccctggggaggctgct
gggattatcccgtgtggacacacctgcctcttccaggacccctgccccgaggcttgctcg
gccacaccttgccatatcccttctgccagcggacttagagtcacagggcaggggcggggt
cagggtggccaccggggacaatgggagggacatggagacttttacagccagggacaaagt
cctgccccgactaaaggcccgctggctggtacggcagctggtaccctagctctggccccg
ccggggtcccagcctgccacagtcctggctttgccgcgcccctgccatcccacagccatg
cagggggcccgggtgctgctgctgctgctgctgctgggcctgaggccacggctggccctt
ggcatcatcccagctgaggaggaggacccagccttctggaaccgccaggcggcccaggcc
ctggacgccgctaagaagctgcagcccatccagacagctgctaagaacctcattctcttt
ttgggggatgggatgggggtgcccacagtgacggccactcggatcctcaaagggcaaatt
aatgacaatctgggacctgagacacccctggccatggaccaatttccatacctggctctg
tccaagacctacaacgtggacagacaggtgccagatagcgcaggcacagccacggcctac
ctgtgcggggtcaaggccaactaccagaccattggtgtgagcgcggccgcccgctttaac
cagtgcaacacgacacgtggcaatgaggtcatctccgtgatgaaccgggccaaaaaagca
gggaagtccgtgggggtggtgaccaccacgagagtgcagcatgcctcgccagccggcacc
tacgcacacgtagtaaaccgcaactggtactcggacgccaacatgcctgccaaggcgctg
gaggacggatgccaggacatcgcccagcagctcatctccaacatggaaattgatgtgatc
ctgggcggaggccgaaagtacatgtttcccaaggggactccggatcctgagtatccaact
gacgccaaacagaacggaatccggttggacgggcggaacctggtgcaggaatggcaggcc
aagtaccagggtgcccggtatgtgtggaatcgcacggcgctcattcaggcatcccaggac
gcctctgtgacacacctcatgggcctctttgagccaggagacaccaaatatgatgtccac
cgagacggaatccaggacccatccctgatggagatgacagaggcggccctgaggctgctg
agcaggaaccccaagggcttctacctctttgtggaaggaggccgcatcgaccacggtcat
cacgacggcacagcttacctggccctgacggaggccgtcatgttcgattccgccattgac
aaggcgggccagctcacgagcgagagggacacactgaccctggtcaccgccgaccactct
cacgtgttctccttcgggggctacaccctgcgagggagctccatcttcgggttggccccc
agcatggccaaagacaacaagacctacacctccatcctgtatggcaacggccccggcttc
gcgctcagcggggtcccccggcccaacgtctccgacgccgagagcagggaccccgcatac
aagccgcaggccgcggtgcccctggactccgagacccacggcggcgaggacgtggcggtg
ttcgcgcgcggcccgcaggcgcacctggtgcacggcgtgcaggagcagagcttcgtggcg
cacgtcatggccttcgccgcctgcctcgagccctacgctgactgcaacctgcagccctcg
gccgcgcccacccccaccccgcagctgatgctgcagctgctgaccggggcgctgctgctc
gcgctgctggcgtag

DBGET integrated database retrieval system