KEGG   Canis familiaris (dog): 474177Help
Entry
474177            CDS       T01007                                 

Gene name
CYP2B6, CYP2B11, CYPIIB11
Definition
cytochrome P450 2B11 (EC:1.14.14.1)
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    474177 (CYP2B6)
   00590 Arachidonic acid metabolism
    474177 (CYP2B6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    474177 (CYP2B6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    474177 (CYP2B6)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     474177 (CYP2B6)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   474177 (CYP2B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 494 aa AA seqDB search
MELSVLLLLALLTGLLLLMARGHPKAYGHLPPGPRPLPILGNFLQMDRKGLLKSFLRLQE
KYGDVFTVYLGPRRTVMLCGIDAIREALVDNAEAFSGRGKIAVVEPVFQGYGVVFANGER
WKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKTEGVLQDPTFFFHSMTANIIC
SIVFGKRFGYKDPEFLRLMNLFYVSFALISSFSSQMFELFHSFLKYFPGTHRQVYNNLQE
IKAFIARMVEKHRETLDPSAPRDFIDAYLIRMDKEKAEPSSEFHHRNLIDTALSLFFAGT
ETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHEIQRFG
DLLPIGVPHMVTKDICFRGYIIPKGTEVFPILHSALNDPHYFEKPDVFNPDHFLDANGAL
KKNEAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSVASPMAPEDIDLTPQEIGVGKL
PPVYQISFLSRGGC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtccttctcctccttgctctcctcacggggctcttgcttctgatggcc
aggggccacccaaaggcttatggccacctcccaccaggcccccgtcctctgcccatcttg
gggaactttcttcagatggacagaaaaggcttactcaaatccttcctcaggctccaagag
aaatatggggatgttttcacggtgtacctggggccaagacgcacggtcatgctatgtggg
atagacgccatacgggaggccctggtggacaatgctgaggccttctctggccggggaaaa
attgctgtagtggagccagtcttccagggatacggtgtagtctttgccaatggggaacgc
tggaagactcttcgccgattctctctggccaccatgagggacttcgggatggggaagcgg
agtgtggaggagcggattcaggaggaggctcagtgtctggtggaagagctgcggaaaact
gagggagtcctccaggaccccaccttcttcttccactccatgaccgccaacatcatctgc
tccattgtctttggaaaacgctttggctacaaagaccctgagttcctgcgcctgatgaac
ttgttctatgtgtccttcgcactcatcagctctttctccagccagatgttcgagcttttc
cacagcttcttgaagtactttcctggcacacacaggcaggtctacaataacctgcaggaa
atcaaagccttcattgcccgcatggtggagaagcaccgggaaaccctggaccccagcgct
ccgcgggacttcatcgacgcctacctgatccgcatggacaaagagaaggccgagcccagc
agcgagttccaccatcggaacctcatagacacggcgctctcgctcttcttcgccggcacg
gagaccaccagcaccacgctccgctacggattcctactcatgctcaaatacccccacatc
gcagaaagaatctacaaggagattgaccaggtgattggcccacaccgtcttccttccctt
gatgaccgagccaaaatgccatacactgatgcagtcatccacgagattcagagatttggg
gaccttctccccattggcgtgccccatatggtcaccaaagatatttgcttcagagggtac
attattcccaagggcactgaagtatttcccatcctgcactctgctctcaatgatccccat
tactttgaaaaaccagatgtcttcaaccctgaccactttctggatgccaatggagcactg
aagaagaatgaagcatttatccccttctccatagggaagcgcatttgtcttggtgaaggc
atcgcccgcatggaattattcctcttcttcaccaccatcctccagaacttctctgtggcc
agccccatggcccctgaggacattgacctcacaccccaggagataggtgtgggcaaattg
cccccagtgtaccagatcagctttctgtctcgtggagggtgctga

DBGET integrated database retrieval system