KEGG   Canis familiaris (dog): 474827Help
Entry
474827            CDS       T01007                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
cfa  Canis familiaris (dog)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    474827 (MRPS18B)
Ribosome [BR:cfa03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    474827 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 257 aa AA seqDB search
MAASALRSWLRPLPGLSPFRSAYGVQVPLQTLCTKGPPEEDSLPPVPISPYKNEPWKYLD
SEEYQNRYSTRPVWADYRRNHKGGIPPQRTRKTCIRRDKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGHLREESGPPPESMPEVPL
SSPTESSSTEESPQSAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgcattgcgttcgtggctgaggccccttcctggcctttcgcccttcaga
agtgcctacggagttcaggttcccctccagactctttgcaccaaaggcccccctgaggaa
gattctttgcccccagttcccataagtccttataagaatgaaccgtggaaatatctggac
tcagaagaataccagaatcgttacagtactcgccctgtctgggctgactaccgtagaaac
cacaaaggtggaatacccccacagcggactcgaaagacatgtattcgtagagataaagtt
gctgggaatccctgccccatctgccgtgatcacaagctgcatgtcgactttaggaacgtg
aagctcctggaacagtttgtctgcgcccacacaggtgtcatcttccatgccccatataca
ggggtctgtatgaagcaacacaagaagttgacccaggccatccagaaagccagagatcat
ggtctcctcagttaccacattcctcaggttgaacctcgggaccttgatttcagtacctct
cacggagctgtgagtgctactccgccagcccccaccctggtttcaggtgacccctggtat
ccatggtacagttggaaacagccaccggagagagagctgtcccgccttcgacggctctat
cagggccatcttcgagaagagagcggtcccccacctgagtcaatgcctgaagtgcccctt
agcagcccaaccgaatcttcctccactgaggagagccctcagagtgctctgtag

DBGET integrated database retrieval system