KEGG   Canis familiaris (dog): 474827Help
Entry
474827            CDS       T01007                                 

Gene name
MRPS18B
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    474827 (MRPS18B)
Ribosome [BR:cfa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    474827 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 474827
NCBI-ProteinID: XP_532057
Ensembl: ENSCAFG00000000411
UniProt: E2R2K6
Position
12
AA seq 257 aa AA seqDB search
MAASALRSWLRPLPGLSPFRSAYGVQVPLQTLCTKGPPEEDSLPPVPISPYKNEPWKYLD
SEEYQNRYSTRPVWADYRRNHKGGIPPQRTRKTCIRRDKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGHLREESGPPPESMPEVPL
SSPTESSSTEESPQSAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgcattgcgttcgtggctgaggccccttcctggcctttcgcccttcaga
agtgcctacggagttcaggttcccctccagactctttgcaccaaaggcccccctgaggaa
gattctttgcccccagttcccataagtccttataagaatgaaccgtggaaatatctggac
tcagaagaataccagaatcgttacagtactcgccctgtctgggctgactaccgtagaaac
cacaaaggtggaatacccccacagcggactcgaaagacatgtattcgtagagataaagtt
gctgggaatccctgccccatctgccgtgatcacaagctgcatgtcgactttaggaacgtg
aagctcctggaacagtttgtctgcgcccacacaggtgtcatcttccatgccccatataca
ggggtctgtatgaagcaacacaagaagttgacccaggccatccagaaagccagagatcat
ggtctcctcagttaccacattcctcaggttgaacctcgggaccttgatttcagtacctct
cacggagctgtgagtgctactccgccagcccccaccctggtttcaggtgacccctggtat
ccatggtacagttggaaacagccaccggagagagagctgtcccgccttcgacggctctat
cagggccatcttcgagaagagagcggtcccccacctgagtcaatgcctgaagtgcccctt
agcagcccaaccgaatcttcctccactgaggagagccctcagagtgctctgtag

DBGET integrated database retrieval system