KEGG   Canis familiaris (dog): 475178Help
Entry
475178            CDS       T01007                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    475178 (GUK1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     475178 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 198 aa AA seqDB search
MSGPRPVVLSGPSGAGKSTLLKRLLQEHGSIFGFSVSHTTRDPRPGEENGKDYYFVTREV
MQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICVLDVDLQGVRNIKKTDLRPIYI
FVQPPSLDVLEQGLRQRNTETEESLAKRLAAAQVDMESSKEQGLFDLVIINDNLEKAYRA
LEEALSEEIKKAQRTSCS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaccaaggcctgtcgtcctgagtggaccgtcaggggcagggaagagcaccctg
ctcaagagactgctgcaggagcacggcagcatctttggcttcagcgtgtcccataccaca
agggacccacggcctggagaagagaatggcaaagattactacttcgtcaccagggaggtg
atgcagcgggacatcgctgcaggcgacttcatcgagcacgctgagttctcggggaacctg
tatgggaccagcaaagcagccgtgcgggccgtgcaggccatgaaccgcatatgcgtgcta
gacgtggacctgcaaggcgtgcgtaacattaagaagactgacctgcggcccatctacatc
ttcgtgcagccaccctcactggatgtcctggagcaggggttgcgccagcgcaacacagag
acagaggagagcctggccaagcggttggctgccgcccaggtggacatggagagcagcaag
gagcagggcctgtttgacctggtcatcatcaacgacaatctggagaaggcttatcgggcc
ctggaggaggcgctatcagaggaaatcaagaaggctcagaggaccagctgctcctga

DBGET integrated database retrieval system