KEGG   Canis familiaris (dog): 476034Help
Entry
476034            CDS       T01007                                 

Gene name
PLCB3
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cfa00562]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:cfa04015]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cfa04310]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cfa04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cfa04070]
Cellular Processes; Cell communication; Gap junction [PATH:cfa04540]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:cfa04062]
Organismal Systems; Endocrine system; Insulin secretion [PATH:cfa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:cfa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:cfa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:cfa04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:cfa04918]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:cfa04919]
Organismal Systems; Endocrine system; Melanogenesis [PATH:cfa04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:cfa04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:cfa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:cfa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:cfa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:cfa04972]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:cfa04961]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:cfa04724]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:cfa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:cfa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:cfa04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:cfa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:cfa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:cfa04723]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:cfa04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:cfa04713]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:cfa05010]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:cfa05016]
Human Diseases; Infectious diseases; Amoebiasis [PATH:cfa05146]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:cfa05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:cfa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 1163 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEKLMTVVAGPDPVNTTFLNFMAVQDDT
AKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVE
TALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLM
DFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYLGGEENGI
LPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWK
GRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAE
YCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNSSVRKRPL
EQSNSALSESSATTDPSSPQLGSPSSESCPGLSNGEEVGLEKPSLEPQKSLGEDGLPRGP
NTLGSADREDEEEEEEEEEQADPKKPTSDEGTASSEVNATEEMSTLVNYIEPVKFKSFEA
ARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNV
GCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVDGIVANA
LRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEPFDFPKVV
LPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIYTEASDY
IPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASPETCQETPSQQPGSQLTPN
PTPSPLDTPPRRPPGPATAPTSPSLSSPGQRDDLIASLLSEVAPIPLEELRGHKALVKLQ
NRQERELRELHKKHQRKAVALTRRLLEGLAQARAESRCRHRPGVLGGENEKEEGEEVKRY
QEFQKRQVQSLLELREAQVDTEAERRLEHLRQAQQRLREVVLDAHTTQFKKLKEINEREK
KELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQKQRQERLV
AGQQQVLQQLAEEEPKLLAQLAQECQEHRARLPQEIRQSLLGETPEGLGDRHLVACASNG
HAPGSSGHLSGADSESQEENTKL
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagcaagttcatcaaatgggacgaggagaagttgatgacggtggtg
gccgggccagacccggtgaatacaacattcttgaacttcatggctgtgcaggatgacaca
gccaaggtctgggccgaggagctgttcaagctggctatgaacatcctggcccagaacgcc
tccaggaataccttcctgcggaaagcatacaccaagctgaagctgcaggtgaaccaggat
ggacggatcccggttaagaatatcctgaagatgttttcagcagataaaaagcgagtggag
accgcactagaatcctgtggcctcaatttcaaccggagtgaatccatccggcccgatgag
ttttccttggaaatctttgagcggttcctgaataagttgtgtctgcggccggacattgac
aagatcctgctagagataggtgctaagggcaagccatacctgacgctggagcagctcatg
gacttcatcaaccagaagcaacgggacccgaggctcaacgaagtgctgtacccacccctg
cggccctcccaggctcggctgctcattgagaagtatgagcccaaccagcagttcctggag
cgagatcagatgtccatggagggcttcagccgctacctgggaggtgaagagaatgggatc
ctgcccctggaggccctggatctgagcgctgacatgacccagccactcagtgcctatttc
atcaactcctcacacaacacctatctcacagcggggcagctggctgggacctcgtcggtg
gagatgtaccggcaggcgctgctgtggggctgccgctgtgtggagctggatgtgtggaaa
gggcggccgccggaggaggagcccttcatcacccacggcttcaccatgaccactgaggtg
ccgctgagagacgtgctcgaggccattgcagaaaccgccttcaagacctcaccctatcca
gtcatcctctccttcgagaatcacgtggactcagcgaagcagcaggccaagatggccgag
tactgccgttccatctttggggacgcgctgctcatcgacccactggacaagtacccgctg
gccccaggtgtccccctgcccagcccccaggacctgatgggccgcatcctggtgaagaac
aagaagcgacaccagcccagcactggtgtccccaacagctctgtgcgcaagcggccgctg
gagcagagcaactcggccctgagcgagagctctgccaccactgacccctcctcacctcag
cttgggtcccccagctctgagagctgcccaggcctgagcaatggggaagaggtgggcctg
gagaagcctagcctggagcctcagaagtctctaggcgaggatgggctcccacggggcccc
aacactcttggatctgctgaccgtgaggatgaggaagaagaggaggaagaggaggaacag
gcagatcctaaaaagccaacctcagatgagggcactgccagcagtgaggtcaatgccact
gaggaaatgtcaacactcgtcaactacattgagcctgtcaagttcaagtcctttgaggct
gctcgaaaaaggaacaaatgctttgagatgtcatccttcgtcgaaaccaaggccatggag
caactgaccaagagccccatggagtttgtggaatacaataaacagcagctcagccgcatc
taccctaagggtacccgcgtggactcatccaactacatgccccagctcttttggaacgtg
ggctgccagcttgttgcactcaacttccagaccctggatgtggcaatgcagctcaacgca
ggcgtgttcgagtacaatgggcgcagtggctatctgctcaaacctgagtttatgcggcgg
ccagacaagtccttcgatcctttcaccgaagtcattgtggatggcattgtggccaatgcc
ttgcgggtcaaggtgatctcggggcagttcctgtccgacaggaaggtgggcatctatgtg
gaggtggacatgtttggcctccccgttgacacgcggcgcaagtaccgtactcggacctct
caagggaactcattcaaccctgtgtgggatgaggaaccttttgacttccccaaggtggtg
ctacccacgctggcttcgctgcgcatcgcggcctttgaggaaggcggcaagtttgtgggg
catcggattctgcccgtctctgccatccgctcagggtaccactacatctgtctgcggaac
gaggccaaccagccactttgcctgccagccctgctcatctacactgaagcctccgactat
attcctgatgaccaccaggactacgcagaggccctgatcaaccccatcaagcatgtcagc
ctgatggaccagagggccaagcagttggccgccctcattggggagagtgaggctcaggcc
agcccagagacatgccaggagactccgtctcagcagccggggtcccagctgaccccaaac
cctacacctagccccctggacacacccccgcgccggcccccaggccctgccacagcccct
accagcccctccctcagcagcccagggcagcgggatgacctcatcgccagcctcctctca
gaggtggccccaatcccgctggaggagctccgaggccataaggcgctggtgaagctccag
aaccggcaagaacgagagctgcgggagctacataagaagcaccagcggaaggccgtcgcc
ctcacccgccggctgcttgagggcctggctcaggcccgggcggagagcaggtgccggcat
cggccaggtgtcctaggcggggagaacgagaaggaagagggagaagaggtaaagcggtat
caggagttccagaagagacaggtgcagagtctgttggagctacgggaggctcaggtggac
acagaggccgagcggaggctggagcacctgagacaggctcagcagcggctcagggaagtt
gtcctggatgctcacacaactcagttcaagaagctgaaggagataaatgagagggagaag
aaggaattgcagaagattttagacaggaagcgccacaacagtatctcagaggccaagact
agggagaaacataagaaggaggcggaactgacagagattaaccgtcggcacatcactgag
tcggtcaactccatccgtcggctggaggaggcccagaagcagcggcaggaacgcctggtg
gctgggcagcagcaggtcctacagcagctggctgaagaggagcccaagctgctggcccag
ctggcccaggagtgtcaggaacatcgagcaaggctgccccaggagatccgccagagcctg
ctgggcgagacaccggaggggctgggggacaggcacctggtggcctgtgccagcaacggt
cacgcacctgggagcagcgggcacctgtctggcgctgactcagagagccaagaggagaat
acgaagctctga

DBGET integrated database retrieval system