KEGG   Canis familiaris (dog): 476511Help
Entry
476511            CDS       T01007                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    476511 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    476511 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    476511 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    476511 (MGLL)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     476511 (MGLL)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S33
   476511 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
20
AA seq 361 aa AA seqDB search
MPPCDRLALILHAAAVVECKSQDMMETGPEDPFRMPEESSPRRTPQSVPYQNLPHLVNAD
GQYLFCRYWKPPGTPKALIFVSHGAGEHCGRYDELAQMLVGLELLVFAHDHVGHGQSEGE
RMVVSDFHVFIRDVLQHVDFMQKDYPGLPVFLLGHSMGGAIAILTAAERPSHFSGMVLIS
PLVLANPESATTFKDYPKSLSELATRRLFSSIPTSLWVLAAKVLNLVLPNMSLGPIDSSV
LSRNKTEVDLYNSDPLICRAGLKVCFGIQLLNAVTRVERALPKLTLPFLLLQGSADRLCD
SKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRIGAAAGTGSP
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgcgaccgcctggctctgatcctccatgctgccgcggttgtggaatgcaaa
agccaggacatgatggaaacaggacctgaagatcctttcaggatgccggaggaaagttcc
cccagacggaccccacagagcgttccgtaccagaacttgcctcacctggtcaatgccgac
gggcagtacctcttctgcaggtactggaaacctccaggcacacccaaggccctcatcttt
gtgtcccatggagctggggagcactgcggccgctatgatgagctggctcagatgctggtg
gggctggagctgctggtgtttgcccacgaccatgttggccatggacagagcgaaggggaa
aggatggtggtgtctgacttccacgttttcatcagggacgtgttacagcacgtggatttc
atgcagaaagactacccagggcttcctgtcttccttctgggccactccatgggaggtgcc
atcgccatcctcacagccgcagagaggccgagccacttctctggcatggtcctgatttca
cctttggttcttgccaatcctgagtctgcaacaactttcaaggattatccgaagagcctg
agcgaactggcaacaagaaggttattctcttctattccaacttctttatgggtcttggct
gcgaaggttctcaaccttgtccttccaaacatgtccctgggcccaatcgactccagcgtg
ctctctcggaataagacggaggtggacctctataattcggaccccctcatctgccgggca
ggcctgaaggtgtgctttggcatccagctgctcaacgctgtcactagagtggagcgggcc
ctccccaagctgaccttgcccttcctgctgctccagggctccgccgaccgcctttgtgac
agcaaaggggcctacttgctcatggagtccgccaagagccaggacaagacactcaagatt
tatgaaggtgcctaccacgtcctccacaaagagcttcctgaagtgaccaactccgttttc
cgcgaaataaacatgtgggtctcccaaaggataggggcggcggcgggaacggggtcccca
ccctga

DBGET integrated database retrieval system