KEGG   Canis familiaris (dog): 479766Help
Entry
479766            CDS       T01007                                 

Gene name
EIF3B, EIF3S9
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit B
  KO
K03253  
translation initiation factor 3 subunit B
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    479766 (EIF3B)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     479766 (EIF3B)
Translation factors [BR:cfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    479766 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 785 aa AA seqDB search
MQDAENVAAPEAAEQRTEPVQQQPAAEPPPGEEPPRPPGPGAQEAASGEDDEAGPEPDEP
AEPAAAAEERAASAPGAPSPPPEEPPAPAPAAGEAPAEQAGDAAAEARSEGAGGEDGGAD
EPSFSDPEDFVDDVSEEELLGDILKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHK
IFSKFGKITNDFYPEEDGKTKGYTFLEYASPAHALDAVKNADGYKLDKQHTFRVNLFTDF
DKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSI
EERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLV
TFSPLMGTQDDPQAIIIWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIY
ETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNL
FNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFA
WEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLR
SMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGR
LLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVER
RRTMMEDFRKYRKMAQELYMEQKSERLELRGGVDTDELDSNVEDWEEETIEFFVTEEIIP
LGNQE
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcggagaacgtggcggcgcccgaggcggccgagcagcggaccgagcccgtg
cagcagcagccggccgctgagccgccaccgggggaggagccgccgcggcccccggggccc
ggcgcgcaggaggcggcgagcggcgaggacgacgaggccgggccggagcccgacgagccg
gccgagcccgcggccgccgcggaggagagggcggcctccgccccgggcgcgccctcgccg
ccgcccgaggagcccccagcccccgccccggctgcgggcgaggccccggcggagcaggcc
ggggacgcggcggccgaggcccggtccgagggggcgggcggggaggacggcggcgcggac
gagccctccttcagcgaccccgaggacttcgtggacgacgtgagcgaggaagaactgctg
ggagacattctcaaggaccggccccaggaggccgacgggatcgactcggtgattgtagtc
gacaacgttcctcaggtgggacccgaccgcctggagaagctcaaaaatgtcatccataag
atcttttccaagtttgggaaaatcacaaatgatttttatccagaggaggatggaaagaca
aaagggtatacattcctggaatacgcatctcctgcccacgccttggatgctgtgaaaaat
gctgatggctacaagctggacaagcagcacacgttcagagtcaacctgttcacagacttt
gacaagtatatgaccatcagtgatgagtgggatattccagagaaacaacctttcaaagac
ttggggaatttacgttactggctcgaagaggcagaatgcagagatcagtacagtgtcata
tttgagagtggggaccgtacttcaatattctggaacgacgtgaaggaccctgtctctatc
gaagagagggcgagatggacagagacatacgtgcgctggtctcctaagggcacttacctg
gccactttccatcagcgaggcattgctctctgggggggagagaaattcaaacaaatccag
agattcagccaccaaggggttcagctcattgacttctcaccttgtgaaagatacctggtg
acattcagccccctgatgggcactcaggatgaccctcaggccatcatcatttgggacatc
ttgaccgggcagaagaagaggggttttcactgcgagagctcagcccattggcctatcttt
aagtggagccatgatggtaaattttttgccagaatgaccctcgacactcttagcatctat
gaaactccctctatgggccttttggacaagaaaagcttgaagatctctggcataaaggac
ttctcttggtctcctggtggtaacatcatagctttttgggtgcctgaggacaaagatatc
ccggccagggtgaccctgatgcagctccctactagacaagaaatcagggttaggaatttg
ttcaatgtcgtggactgcaagctacattggcagaaaaatggagattacttgtgtgttaaa
gtggataggactcccaagggaacccagggcgttgttacaaattttgaaattttccgaatg
agggaaaaacaggtaccagtcgacgtggtggaaatgaaagaaaccatcatagccttcgcc
tgggagccgaacgggagtaagtttgccgtgttgcatggggaggctcctcggatatccgtt
tccttctaccacgtgaagaacaacgggaagattgagcttatcaaaatgtttgataagcag
caggcaaataccatcttctggagcccccagggacagtttgtcgtgttggctggcctaagg
agtatgaatggtgccttggcttttgttgacacctcggactgtacagtcatgaacattgca
gagcactacatggcctctgacgtggagtgggaccctactggacgctacgttgtcacctct
gtgtcctggtggagccataaggtggacaacgcttactggctgtggactttccaaggacgc
ctcctgcagaagaacaacaaggaccgcttttgccagctcctgtggagacctcggcccccc
acgctcctgagccaggatcagataaagcaaattaaaaaggatctgaagaaatactccaag
atctttgaacagaaggatcgtctgagccaatccaaagcctcaaaggaactggtggagagg
agacgcaccatgatggaagatttcagaaaataccggaaaatggcccaggagctctacatg
gagcagaagagtgaacgtctggaattgcgaggaggcgtggacaccgacgagctggacagc
aacgtggaggactgggaagaggagaccatcgagttcttcgtcactgaggagatcatcccc
ctgggaaatcaggagtga

DBGET integrated database retrieval system