KEGG   Canis familiaris (dog): 479766Help
Entry
479766            CDS       T01007                                 

Gene name
EIF3B, EIF3S9
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    479766 (EIF3B)
Translation factors [BR:cfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    479766 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 813 aa AA seqDB search
MARRQAARGAAWESRKRGADGRGGSGGPMQDAENVAAPEAAEQRTEPVQQQPAAEPPPGE
EPPRPPGPGAQEAASGEDDEAGPEPDEPAEPAAAAEERAASAPGAPSPPPEEPPAPAPAA
GEAPAEQAGDAAAEARSEGAGGEDGGADEPSFSDPEDFVDDVSEEELLGDILKDRPQEAD
GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYTFLEYASPA
HALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAE
CRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWG
GEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMGTQDDPQAIIIWDILTGQKKRGFHCE
SSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAF
WVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVV
TNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIE
LIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDP
TGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIK
KDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKSERLELRGG
VDTDELDSNVEDWEEETIEFFVTEEIIPLGNQE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcggcaggcggcgcgcggggcggcctgggagagtcggaagcgcggcgcggac
gggcgaggaggcagcggcgggcccatgcaggacgcggagaacgtggcggcgcccgaggcg
gccgagcagcggaccgagcccgtgcagcagcagccggccgctgagccgccaccgggggag
gagccgccgcggcccccggggcccggcgcgcaggaggcggcgagcggcgaggacgacgag
gccgggccggagcccgacgagccggccgagcccgcggccgccgcggaggagagggcggcc
tccgccccgggcgcgccctcgccgccgcccgaggagcccccagcccccgccccggctgcg
ggcgaggccccggcggagcaggccggggacgcggcggccgaggcccggtccgagggggcg
ggcggggaggacggcggcgcggacgagccctccttcagcgaccccgaggacttcgtggac
gacgtgagcgaggaagaactgctgggagacattctcaaggaccggccccaggaggccgac
gggatcgactcggtgattgtagtcgacaacgttcctcaggtgggacccgaccgcctggag
aagctcaaaaatgtcatccataagatcttttccaagtttgggaaaatcacaaatgatttt
tatccagaggaggatggaaagacaaaagggtatacattcctggaatacgcatctcctgcc
cacgccttggatgctgtgaaaaatgctgatggctacaagctggacaagcagcacacgttc
agagtcaacctgttcacagactttgacaagtatatgaccatcagtgatgagtgggatatt
ccagagaaacaacctttcaaagacttggggaatttacgttactggctcgaagaggcagaa
tgcagagatcagtacagtgtcatatttgagagtggggaccgtacttcaatattctggaac
gacgtgaaggaccctgtctctatcgaagagagggcgagatggacagagacatacgtgcgc
tggtctcctaagggcacttacctggccactttccatcagcgaggcattgctctctggggg
ggagagaaattcaaacaaatccagagattcagccaccaaggggttcagctcattgacttc
tcaccttgtgaaagatacctggtgacattcagccccctgatgggcactcaggatgaccct
caggccatcatcatttgggacatcttgaccgggcagaagaagaggggttttcactgcgag
agctcagcccattggcctatctttaagtggagccatgatggtaaattttttgccagaatg
accctcgacactcttagcatctatgaaactccctctatgggccttttggacaagaaaagc
ttgaagatctctggcataaaggacttctcttggtctcctggtggtaacatcatagctttt
tgggtgcctgaggacaaagatatcccggccagggtgaccctgatgcagctccctactaga
caagaaatcagggttaggaatttgttcaatgtcgtggactgcaagctacattggcagaaa
aatggagattacttgtgtgttaaagtggataggactcccaagggaacccagggcgttgtt
acaaattttgaaattttccgaatgagggaaaaacaggtaccagtcgacgtggtggaaatg
aaagaaaccatcatagccttcgcctgggagccgaacgggagtaagtttgccgtgttgcat
ggggaggctcctcggatatccgtttccttctaccacgtgaagaacaacgggaagattgag
cttatcaaaatgtttgataagcagcaggcaaataccatcttctggagcccccagggacag
tttgtcgtgttggctggcctaaggagtatgaatggtgccttggcttttgttgacacctcg
gactgtacagtcatgaacattgcagagcactacatggcctctgacgtggagtgggaccct
actggacgctacgttgtcacctctgtgtcctggtggagccataaggtggacaacgcttac
tggctgtggactttccaaggacgcctcctgcagaagaacaacaaggaccgcttttgccag
ctcctgtggagacctcggccccccacgctcctgagccaggatcagataaagcaaattaaa
aaggatctgaagaaatactccaagatctttgaacagaaggatcgtctgagccaatccaaa
gcctcaaaggaactggtggagaggagacgcaccatgatggaagatttcagaaaataccgg
aaaatggcccaggagctctacatggagcagaagagtgaacgtctggaattgcgaggaggc
gtggacaccgacgagctggacagcaacgtggaggactgggaagaggagaccatcgagttc
ttcgtcactgaggagatcatccccctgggaaatcaggagtga

DBGET integrated database retrieval system