KEGG   Canis familiaris (dog): 608177Help
Entry
608177            CDS       T01007                                 

Gene name
MYL10
Definition
(RefSeq) myosin light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04510  Focal adhesion
cfa04670  Leukocyte transendothelial migration
cfa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    608177 (MYL10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    608177 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    608177 (MYL10)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     608177 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 608177
NCBI-ProteinID: XP_850206
Ensembl: ENSCAFG00000013765
Position
6
AA seq 167 aa AA seqDB search
MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFI
KEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYQNLCYVITHGEEKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcggagagcccgcaagagagcagaaggcggagccagctctaacgtcttctcc
atgtttgatcaatcccagatccaggagtttaaagaggccttcaccatcatggaccagaac
cgggatggcttcatcgacaaggaggacctgagggacacctttgctgccttgggccgcatc
aatgtgaaaaatgaggagctggaggccatggtgaaggaggcccctgggcccatcaacttc
accgtcttcctgaccatgtttggggagaaactgaagggtacagaccctgaggagaccatt
ctccacgccttcaaagtctttgacaccgaaggaaaaggtttcgtcaaggctgatttcatc
aaagagaagctcatgacccaggcagaccggttcagtgaggaggaggtcaagcagatgttt
gcggctttcccgccagatgtgtgtggtaacctggactaccagaacctgtgctacgtcatc
acacacggtgaggagaaggactag

DBGET integrated database retrieval system