KEGG   Canis familiaris (dog): 611939Help
Entry
611939            CDS       T01007                                 

Gene name
MAP2K2
Definition
mitogen-activated protein kinase kinase 2 (EC:2.7.12.2)
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Prion diseases
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:cfa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:cfa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cfa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cfa04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:cfa04370]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:cfa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cfa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:cfa04810]
Cellular Processes; Cell communication; Gap junction [PATH:cfa04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:cfa04620]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:cfa04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:cfa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:cfa04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:cfa04664]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:cfa04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:cfa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:cfa04915]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:cfa04917]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:cfa04921]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:cfa04919]
Organismal Systems; Endocrine system; Melanogenesis [PATH:cfa04916]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:cfa04270]
Organismal Systems; Nervous system; Long-term potentiation [PATH:cfa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:cfa04730]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:cfa04722]
Human Diseases; Cancers; Pathways in cancer [PATH:cfa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:cfa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:cfa05205]
Human Diseases; Cancers; Glioma [PATH:cfa05214]
Human Diseases; Cancers; Thyroid cancer [PATH:cfa05216]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:cfa05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:cfa05220]
Human Diseases; Cancers; Melanoma [PATH:cfa05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:cfa05211]
Human Diseases; Cancers; Bladder cancer [PATH:cfa05219]
Human Diseases; Cancers; Prostate cancer [PATH:cfa05215]
Human Diseases; Cancers; Endometrial cancer [PATH:cfa05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:cfa05223]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:cfa05020]
Human Diseases; Infectious diseases; Influenza A [PATH:cfa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:cfa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 400 aa AA seqDB search
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGIEGEPHSISPRPRP
PGRPISGHGTDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMSHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcactatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctagcagagctagaacttgatgagcagcagaagaagcgactggaagccttcctcacccag
aaggccaaggtcggggaactcaaggatgatgacttcgaacggatctcagagctgggagcc
gggaacggcggggtggtcaccaaggtccagcacagaccttctggcctcatcatggcgaga
aagctgatccacctggaaatcaagccggccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgtaactccccgtacatcgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcatatggatggcggctctctggaccaggtgttgaag
gaagccaagagaatccctgaggagatcctggggaaggtcagcattgcggttctccggggt
ttggcgtatctccgggagaagcaccagatcatgcaccgagacgtgaaaccatccaacatc
ctcgtcaactcccgaggggagattaagctgtgtgattttggggtgagcggccagctcatc
gactccatggccaactccttcgtgggaactcggtcctacatgtctccagagcggttgcag
ggcactcattactcagtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccattggaaggtaccccatcccgccaccagatgccaaggagctagaggccatcttcggc
cggcccatggttgacgggatagaaggagagcctcacagcatctcaccacggccgagaccc
cctggacgccccatcagcggtcatgggacggacagccggccagctatggccatctttgag
ctgctggactatattgtgaacgagccgcctcccaagctgcccaatggtgtcttcacccag
gacttccaggagtttgtaaataaatgcctaataaagaacccagcagagcgagcagatctg
aagatgctcatgagccacacgttcatcaagcggtccgaggtggaagaggtggattttgcc
ggctggttgtgtaaaacgctgcggctgaatcagcccagtacgcccacgcgcaccgccgtg
tga

DBGET integrated database retrieval system