KEGG   Chlamydophila felis: CF0586Help
Entry
CF0586            CDS       T00332                                 

Gene name
sucB1
Definition
(RefSeq) dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfe  Chlamydophila felis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CF0586 (sucB1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CF0586 (sucB1)
  Amino acid metabolism
   00310 Lysine degradation
    CF0586 (sucB1)
Enzymes [BR:cfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CF0586 (sucB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(688394..689491)
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVASESLVQENQGIMEIESEKVNQLIYAPVSGRIIWSV
AEGDVVSVGGVVAQISDAHESSSVGSMEESPKDATVDAEIICFPRSKAHEPPAEGKTFVP
LRDKIQNVPQSSGSKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
RQEAFFSRYNVKLGLMSFFVKAVIEGLKSYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEMRLADLASRARDGLISVPELEGGSFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
TLIDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaagtacgcattccaaatgtcgctgaatcaataagtgaagtgacgatagct
tctctgttagtggcttcagaaagtttggttcaggagaatcagggcattatggaaatagaa
agcgagaaggtaaatcagcttatctatgcccccgtatccggaaggatcatttggtctgtt
gctgaaggagatgttgtttctgttggtggtgtcgttgctcaaatttctgatgctcatgaa
tctagttccgtaggctctatggaagaatctcctaaagacgcgactgtagatgcggaaatt
atctgtttcccgagatctaaagctcatgagccccccgcagaagggaagacctttgttcct
ttacgggataaaatccaaaatgtcccacaatcttcaggatctaagaatgaagttcgtgag
cgtatgtcgtcaatacgcaaaacgatttctcgtcgtttagttactgctcttcatgaatcg
gcaatgttaacaacattcaacgagattcatatgacgcctcttatgcaactccgcaaggaa
agacaagaagcctttttctctcgctataacgtgaaactaggattgatgtcattctttgta
aaagctgttattgaaggattaaaatcatatcctcgtgtaaacgcatacattgatggagat
gaaattgtctatcgtcagtattacgatatttctattgctgtagggactgaacgtggtctt
gttgttccagtaattcgtgaatgcgataaactctctagcggagacattgagatgagactt
gctgatttagcaagtagagctcgtgatggactgatttctgttcctgaactagaaggcgga
agttttactattactaatgggggtgtctatggttctctactttccacgcctattattaat
cctccgcaagtagggatattagggatgcataaaatagaaaagcgcccagtagttattgat
aatacaattgccattgcagatatgatgtatgtagcttttagctatgatcatcgcattatt
gatggtaaggaagctgtagggtttcttattaaaatcaaagatgcaatagagcagcctgaa
actcttatcgatttttaa

DBGET integrated database retrieval system