KEGG   Chlamydophila felis: CF0586Help
Entry
CF0586            CDS       T00332                                 

Gene name
sucB1
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfe  Chlamydophila felis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cfe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cfe00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cfe00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(688394..689491)
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVASESLVQENQGIMEIESEKVNQLIYAPVSGRIIWSV
AEGDVVSVGGVVAQISDAHESSSVGSMEESPKDATVDAEIICFPRSKAHEPPAEGKTFVP
LRDKIQNVPQSSGSKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
RQEAFFSRYNVKLGLMSFFVKAVIEGLKSYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEMRLADLASRARDGLISVPELEGGSFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
TLIDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaagtacgcattccaaatgtcgctgaatcaataagtgaagtgacgatagct
tctctgttagtggcttcagaaagtttggttcaggagaatcagggcattatggaaatagaa
agcgagaaggtaaatcagcttatctatgcccccgtatccggaaggatcatttggtctgtt
gctgaaggagatgttgtttctgttggtggtgtcgttgctcaaatttctgatgctcatgaa
tctagttccgtaggctctatggaagaatctcctaaagacgcgactgtagatgcggaaatt
atctgtttcccgagatctaaagctcatgagccccccgcagaagggaagacctttgttcct
ttacgggataaaatccaaaatgtcccacaatcttcaggatctaagaatgaagttcgtgag
cgtatgtcgtcaatacgcaaaacgatttctcgtcgtttagttactgctcttcatgaatcg
gcaatgttaacaacattcaacgagattcatatgacgcctcttatgcaactccgcaaggaa
agacaagaagcctttttctctcgctataacgtgaaactaggattgatgtcattctttgta
aaagctgttattgaaggattaaaatcatatcctcgtgtaaacgcatacattgatggagat
gaaattgtctatcgtcagtattacgatatttctattgctgtagggactgaacgtggtctt
gttgttccagtaattcgtgaatgcgataaactctctagcggagacattgagatgagactt
gctgatttagcaagtagagctcgtgatggactgatttctgttcctgaactagaaggcgga
agttttactattactaatgggggtgtctatggttctctactttccacgcctattattaat
cctccgcaagtagggatattagggatgcataaaatagaaaagcgcccagtagttattgat
aatacaattgccattgcagatatgatgtatgtagcttttagctatgatcatcgcattatt
gatggtaaggaagctgtagggtttcttattaaaatcaaagatgcaatagagcagcctgaa
actcttatcgatttttaa

DBGET integrated database retrieval system