KEGG   Cellulomonas fimi: Celf_2211Help
Entry
Celf_2211         CDS       T01490                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfi  Cellulomonas fimi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_2211
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celf_2211
  Amino acid metabolism
   00310 Lysine degradation
    Celf_2211
Enzymes [BR:cfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celf_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2448660..2450519
Genome map
AA seq 619 aa AA seqDB search
MSDNVQLPALGESVTEGTVTRWLKNVGDRVEVDEPLLEISTDKVDTEIPSPFAGVLEQIL
VQEDETVEVGATLAVIGSGEGAGGDGAAQDAAPQEAPAEQAPAEEPAAEAQPAQQPVEQH
EEAAPAPAAEQPAEQPAAAQGSSGDGQEVTLPALGESVTEGTVTRWLKAVGDTVEVDEPL
LEISTDKVDTEIPSPVAGTVQEIRVQEDETVEVGAVLAIVGSGAATPAAAPAPAAPAPAP
APQAEPAPVPATPAPAPAQPAAPQAGGYEAPAPEAESAQSAGQAPAAQQAAAQQPTASAT
TASAASAAGSYLTPLVRKLAAEKGVDVTTLTGTGVGGRIRKEDVLEAAAKAEAAKAAQAA
PAAEAPAAAAPKAASVPSVSPLRGTTEKASRLRQIIAERMVEALHTQAQLTTVVEVDVTK
VARLRARAKDDFKAREGVNLTFLPFFVQAAVESLKAYPKINGVLEGNQITYHGQENVAIA
VDTERGLLTPVIRDAGDLNLAGIARKIADLAARTRANKVTPDELSGATFTVTNTGSGGAL
IDTPIVPTGTSAILGTGAIVKRPVVVKGADGEEVIAIRSMCYLCLSYDHRLVDGADASRY
LSAVKARIEEGAFESEVGL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaacgtgcagcttcccgctctcggtgagtccgtcaccgagggcaccgtcacc
cgctggctgaagaacgtgggcgaccgcgtggaggtcgacgagcccctgctcgagatctcg
accgacaaggtcgacaccgagatcccgtcgccgttcgcgggcgtgctcgagcagatcctc
gtccaggaggacgagaccgtcgaggtcggcgccacgctggccgtcatcggctccggcgag
ggtgcgggcggcgacggcgccgcccaggacgcggccccgcaggaggcgcccgccgagcag
gcgcccgccgaggagcccgccgccgaggcgcagcccgcgcagcagcccgtcgagcagcac
gaggaggcggcgcccgcgccggccgccgagcagccggccgagcagcccgcagcggcgcag
gggtcgtccggcgacggccaggaggtcaccctccccgcgctcggcgagtccgtgaccgag
ggcaccgtcacccgctggctcaaggccgtcggcgacaccgtcgaggtcgacgagccgctg
ctcgagatctccaccgacaaggtcgacaccgagatcccgtcgcccgtcgcgggcaccgtg
caggagatccgcgtccaggaggacgagaccgtcgaggtcggcgccgtcctggcgatcgtg
ggctccggtgccgccaccccggcggccgcacccgccccggctgccccggcccccgcgccc
gctccgcaggccgagccggcccccgtgccggccacgcccgctcccgcgcccgcgcagccc
gcggccccgcaggccggcggctacgaggcgcccgcgcccgaggccgagtcggcgcagtcc
gccggccaggcccccgccgcgcagcaggccgccgcgcagcagccgaccgcctcggcgacc
accgcgtcggcagcgagcgccgccggctcctacctcaccccgctcgtccgcaagctcgcg
gccgagaagggggtcgacgtcacgaccctcacgggcacgggcgtcggcggccgcatccgc
aaggaggacgtgctcgaggcagccgcgaaggcggaggccgccaaggccgcgcaggcggca
cccgccgccgaggctccggcagcggccgcacccaaggccgcgtccgtcccgtcggtgtct
ccgctgcgcggcaccaccgagaaggcgagccggctgcggcagatcatcgccgagcgcatg
gtcgaggccctgcacacgcaggcgcagctcacgaccgtggtcgaggtcgacgtcaccaag
gtcgcccgcctgcgcgcccgcgcgaaggacgacttcaaggctcgcgagggtgtgaacctc
acgttcctgccgttcttcgtccaggccgcggtcgagtcgctcaaggcctacccgaagatc
aacggggtgctcgagggcaaccagatcacctaccacggccaggagaacgtggcgatcgcg
gtcgacaccgagcgcggcctgctcacgcccgtgatccgcgacgcgggcgacctcaacctc
gccggcatcgcgcgcaagatcgccgacctcgcggcccgcacgcgcgccaacaaggtcacg
ccggacgagctgtccggtgcgacgttcacggtcacgaacaccggctcgggcggcgcgctc
atcgacacgccgatcgtcccgaccggaacgtcggccatcctcggcacgggcgcgatcgtc
aagcgccccgtcgtggtcaagggcgcggacggcgaggaggtcatcgcgatccggtcgatg
tgctacctgtgcctgtcgtacgaccaccggctcgtcgacggcgcggacgcgtcgcgctac
ctctccgcggtcaaggcccgcatcgaggagggcgcgttcgagtccgaggtcggcctctga

DBGET integrated database retrieval system