KEGG   Camelus ferus (Wild Bactrian camel): 102505473Help
Entry
102505473         CDS       T02979                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    102505473 (ABAT)
   00650 Butanoate metabolism
    102505473 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102505473 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102505473 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102505473 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    102505473 (ABAT)
Enzymes [BR:cfr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102505473 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102505473 (ABAT)
Amino acid related enzymes [BR:cfr01007]
 Aminotransferase (transaminase)
  Class III
   102505473 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MASMLLTRRLACRFQHSYHLLVPGSRQISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNVIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALMKLVQQPQ
NVSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSGFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPQLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLVGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgctgctcacccggcggctggcctgcagattccaacacagctaccacctg
cttgtgcccggatctagacagatcagtcaggctgcagccaaagtcgacgttgaatttgat
tatgacgggcctttgatgaagacagaagtcccagggcctcgatctcgggagttaatgaaa
cagctaaatgtaattcagaatgcagaggccgtgcactttttctgcaattatgaagagagc
cgaggcaattacctggtagatgtggatggcaaccggatgttggatctttattcccagatc
tcctcggtccccataggttacagccatcccgctctcatgaaactcgtccaacagcctcaa
aatgtgagcacattcatcaacagacctgccctcggaatccttcctccagagaactttgtg
gagaagctccgggagtccctgctctcggtggctcccaaaggaatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaacgccttcaagaccatcttcatgtggtatcgg
agcaaggaaaggggccagtcaggtttctccaaggaggagctggagacgtgcatgattaac
caggcccccgggtgccctgactacagcatcctctccttcatgggcgcgttccacgggagg
accatgggttgcttagcgaccacgcactccaaagccattcacaagattgacatcccttcc
ttcgactggcccatcgcaccattcccccagctgaagtatcccctggaagagtttgtgaag
gagaaccagcaggaagaggcccgctgtctagaagaggtggaggacctgatcgtgaagtac
cggaagaagaagaagacagtggctgggatcatcgtggagcccatccagtcagagggcgga
gacaaccatgcatcagacgacttcttccggaagctgagagacatctccaggaagcacggc
tgcgccttcttggtggatgaggtccagacaggagggggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgacccggcagacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcccaacgctccttaccggatcttcaac
acgtggctgggggacccatccaagaacctgctgctggccgaggtcatcaacattatcaag
cgggaggaccttctgaacaacgccgcgcatgccgggaaggccctgctcgtgggcctgctg
gacctccaggcccggtacccccagttcatcagcagagtgagaggacgaggcaccttctgc
tccttcgacactccagacgaatccatacggaataaactcatttcaatagctagaaacaaa
ggcgtgatgctggggggctgcggcgacaagtccatccgtttccgtcccactctggtcttc
agggatcaccatgcacacctgttcctcaatattttcagcgacatcttagccgacttcaag
taa

DBGET integrated database retrieval system