KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1789Help
Entry
cg1789            CDS       T00244                                 

Gene name
tpi
Definition
(GenBank) TRIOSEPHOSPHATE ISOMERASE
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00010  Glycolysis / Gluconeogenesis
cgb00051  Fructose and mannose metabolism
cgb00562  Inositol phosphate metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01130  Biosynthesis of antibiotics
cgb01200  Carbon metabolism
cgb01230  Biosynthesis of amino acids
Module
cgb_M00002  Glycolysis, core module involving three-carbon compounds
cgb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg1789 (tpi)
   00051 Fructose and mannose metabolism
    cg1789 (tpi)
   00562 Inositol phosphate metabolism
    cg1789 (tpi)
Enzymes [BR:cgb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cg1789 (tpi)
Exosome [BR:cgb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cg1789 (tpi)
  Exosomal proteins of bladder cancer cells
   cg1789 (tpi)
  Exosomal proteins of melanoma cells
   cg1789 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAF21594
UniProt: P19583
Position
complement(1681797..1682576)
Genome map
AA seq 259 aa AA seqDB search
MARKPLIAGNWKMNLDHQQAIGTVQKLAFALPKEYFEKVDVAVTVPFTDIRSVQTLVEGD
KLEVTFGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNESDELVAAKAKA
ALSNGISPIVCVGEPLEIREAGTHVEYVVEQTRKSLAGLDAAELANTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIVELAGDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAASVA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaagccacttatcgctggtaactggaagatgaacctggatcaccagcaggca
atcggcactgttcagaagcttgcattcgcccttccaaaggaatacttcgagaaggttgac
gttgcagtcaccgttcctttcactgacatccgctccgtccagactctcgttgagggcgac
aagcttgaggtcactttcggtgctcaggacgtctcccagcacgagtccggtgcgtacacc
ggtgaagtttctgcaagcatgctggcaaagttgaactgctcttgggttgtcgttggacac
tccgagcgccgcgagtaccacaacgagtctgatgagttggttgctgcgaaggcaaaggca
gctctgtccaacggcatcagcccgatcgtctgcgttggtgagccactggaaatccgtgaa
gctggcacccacgttgagtacgtcgtcgagcagacccgtaagtcccttgctggcctggat
gctgctgagctggccaacaccgttatcgcgtatgagccagtgtgggctatcggcaccggt
aaggttgcttccgcagctgacgctcaggaagtgtgcaaggctatccgcggtctgatcgtg
gagcttgcaggcgacgaggtcgctgagggcctgcgtattctttacggtggttctgttaag
gcagaaaccgtcgctgagatcgtcggtcagcctgacgtcgacggcggacttgtcggtggc
gcttccctcgacggtgaagcattcgccaagctggctgccaacgctgcgagcgttgcttaa

DBGET integrated database retrieval system