KEGG   Cyanobium gracile: Cyagr_3027Help
Entry
Cyagr_3027        CDS       T02359                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cgc  Cyanobium gracile
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyagr_3027
  Amino acid metabolism
   00340 Histidine metabolism
    Cyagr_3027
Enzymes [BR:cgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Cyagr_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2952539..2953921)
Genome map
AA seq 460 aa AA seqDB search
MVASTPTGSSPAAAPAATCDTGGDRPALRITCLRDGQRAGERLEAIAARTESGRLREEEA
RVAAILVEVRQRGDAALLDFSERFDGLRPDPLRVPPERLAQAWHDCPDPLRRALDLAHDR
ILDFHRRQMPADLAVTGPHGERLGRRWRPVQRAGIYVPGGRASYPSTVLMNAIPAQVAGV
ERLVMVTPPGPGGEPNATVLAAAHRAGVEEVYRVGGAQAIAALAYGTETVPAVDVISGPG
NLYVTLAKKAVYGKVGIDSLAGPSEVLVIADHSARPAQVAADLMAQAEHDPLAAAILITT
SEELAAAVPAAIEAQLERHPRAAITLQALNDWGLIVVCDDLAEAAALSDRFAPEHLELLV
DDPESLADRITHAGAIFLGPWSPEAVGDYLAGPNHTLPTSGTARFAGALSVETFLRHTSL
IHFNRTALEATGPAVVTLAESEGLHSHAESVRQRLGTQHS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcttccaccccaaccggcagcagccctgccgccgcccctgccgccacctgtgac
acaggcggggaccggccggcgctgcggatcacctgcctgcgggacggccagcgggccggc
gaacggctcgaagcgatcgccgcccgcaccgagagcggccgcctgcgcgaggaggaagcg
cgggtcgcggcgatcctggtcgaggtgaggcagcgcggcgacgccgccctgctcgacttc
agcgagcgcttcgacggcctgcggcccgatcccctgcgggtgccccccgagcggctggcc
caggcctggcacgactgccccgatcccctgcgccgggccctcgacctggcccacgaccgg
atcctggacttccaccgccgccagatgccggcggatctggccgtcaccggcccccacggc
gagcggctggggcgccgctggcgcccggtgcagcgggcggggatctacgtccccggtggc
cgggcctcttaccccagcacggtgctgatgaatgccattcccgcccaggtggccggcgtg
gagcggctggtgatggtcaccccgcccggcccgggcggcgaaccgaacgccaccgtgctg
gccgccgcccaccgggccggggtggaggaggtctaccgggtgggcggcgcccaggcgatc
gcggccctggcctacggcaccgaaacggtccccgccgtcgatgtgatcagcggccccggc
aatctctacgtgaccctggccaagaaggccgtgtacggcaaggtcggcattgactccctg
gccggccccagcgaggtgctggtgatcgccgaccacagcgcgaggcccgcccaggtggcc
gccgacctgatggcccaggcggagcacgatcccctggcggcggcgatcctgatcaccacc
agcgaggagctggccgccgccgtgccggccgccatcgaagcccaactggagcgccacccg
cgggccgccatcaccctgcaggccctcaacgactgggggttgatcgtggtctgcgacgat
ctggccgaagcggcggccctcagcgaccggttcgccccggagcacctcgagctgctggtg
gacgatcccgaatccctggcggaccggatcacccacgccggcgccatcttcctcggcccc
tggtcgcccgaggcggtgggcgactacctggccggccccaaccacaccctgcccacctcc
ggcaccgcccgcttcgccggcgccctgagcgtcgagaccttcctgcgccacaccagcctg
atccacttcaaccggaccgccctggaggccaccgggccggccgtggtcaccctggccgag
agcgagggactgcacagccacgcggaatcggtgcgccagcggctcgggacccagcacagc
tga

DBGET integrated database retrieval system