KEGG   Cricetulus griseus (Chinese hamster): 100757614
Entry
100757614         CDS       T02813                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05207  Chemical carcinogenesis - receptor activation
cge05208  Chemical carcinogenesis - reactive oxygen species
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100757614 (Nras)
   04012 ErbB signaling pathway
    100757614 (Nras)
   04014 Ras signaling pathway
    100757614 (Nras)
   04015 Rap1 signaling pathway
    100757614 (Nras)
   04370 VEGF signaling pathway
    100757614 (Nras)
   04371 Apelin signaling pathway
    100757614 (Nras)
   04068 FoxO signaling pathway
    100757614 (Nras)
   04072 Phospholipase D signaling pathway
    100757614 (Nras)
   04071 Sphingolipid signaling pathway
    100757614 (Nras)
   04151 PI3K-Akt signaling pathway
    100757614 (Nras)
   04150 mTOR signaling pathway
    100757614 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100757614 (Nras)
   04137 Mitophagy - animal
    100757614 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    100757614 (Nras)
   04218 Cellular senescence
    100757614 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100757614 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    100757614 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100757614 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100757614 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    100757614 (Nras)
   04660 T cell receptor signaling pathway
    100757614 (Nras)
   04662 B cell receptor signaling pathway
    100757614 (Nras)
   04664 Fc epsilon RI signaling pathway
    100757614 (Nras)
   04062 Chemokine signaling pathway
    100757614 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100757614 (Nras)
   04929 GnRH secretion
    100757614 (Nras)
   04912 GnRH signaling pathway
    100757614 (Nras)
   04915 Estrogen signaling pathway
    100757614 (Nras)
   04917 Prolactin signaling pathway
    100757614 (Nras)
   04921 Oxytocin signaling pathway
    100757614 (Nras)
   04926 Relaxin signaling pathway
    100757614 (Nras)
   04935 Growth hormone synthesis, secretion and action
    100757614 (Nras)
   04919 Thyroid hormone signaling pathway
    100757614 (Nras)
   04916 Melanogenesis
    100757614 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    100757614 (Nras)
   04726 Serotonergic synapse
    100757614 (Nras)
   04720 Long-term potentiation
    100757614 (Nras)
   04730 Long-term depression
    100757614 (Nras)
   04722 Neurotrophin signaling pathway
    100757614 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    100757614 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    100757614 (Nras)
   04213 Longevity regulating pathway - multiple species
    100757614 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    100757614 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100757614 (Nras)
   05206 MicroRNAs in cancer
    100757614 (Nras)
   05205 Proteoglycans in cancer
    100757614 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    100757614 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    100757614 (Nras)
   05203 Viral carcinogenesis
    100757614 (Nras)
   05230 Central carbon metabolism in cancer
    100757614 (Nras)
   05231 Choline metabolism in cancer
    100757614 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100757614 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100757614 (Nras)
   05225 Hepatocellular carcinoma
    100757614 (Nras)
   05226 Gastric cancer
    100757614 (Nras)
   05214 Glioma
    100757614 (Nras)
   05216 Thyroid cancer
    100757614 (Nras)
   05221 Acute myeloid leukemia
    100757614 (Nras)
   05220 Chronic myeloid leukemia
    100757614 (Nras)
   05218 Melanoma
    100757614 (Nras)
   05211 Renal cell carcinoma
    100757614 (Nras)
   05219 Bladder cancer
    100757614 (Nras)
   05215 Prostate cancer
    100757614 (Nras)
   05213 Endometrial cancer
    100757614 (Nras)
   05224 Breast cancer
    100757614 (Nras)
   05223 Non-small cell lung cancer
    100757614 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100757614 (Nras)
   05170 Human immunodeficiency virus 1 infection
    100757614 (Nras)
   05161 Hepatitis B
    100757614 (Nras)
   05160 Hepatitis C
    100757614 (Nras)
   05163 Human cytomegalovirus infection
    100757614 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100757614 (Nras)
   05165 Human papillomavirus infection
    100757614 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100757614 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    100757614 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    100757614 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100757614 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100757614 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100757614 (Nras)
   01522 Endocrine resistance
    100757614 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100757614 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100757614 (Nras)
   04031 GTP-binding proteins [BR:cge04031]
    100757614 (Nras)
Membrane trafficking [BR:cge04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100757614 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100757614 (Nras)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100757614 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   100757614 (Nras)
  Exosomal proteins of breast cancer cells
   100757614 (Nras)
  Exosomal proteins of colorectal cancer cells
   100757614 (Nras)
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100757614 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 100757614
NCBI-ProteinID: XP_027249625
UniProt: A0A061INW8
Position
1
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgaca
atccagttaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtaattgatggtgagacttgtctgttggacatactggacacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggattcctctgt
gtatttgccatcaacaatagcaaatcatttgcagatattaacctctacagagagcagatt
aaacgagtgaaagactctgatgatgtgcctatggtgctggtcgggaacaaatgtgacttg
ccaacaaggacagttgacacaaagcaagcccatgagctggccaagagttatggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaagatgccttttacacactagta
agggagatacgccagtaccgaatgaaaaagctcaacagcaatgatgatggcactcaaggt
tgtatggggttgccctgtgtggtaatgtaa

  All links  
Ontology (4)   
   KEGG BRITE (4)   
Pathway (80)   
   KEGG PATHWAY (80)   
Genome (1)   
   KEGG GENOME (1)   
Gene (11)   
   KEGG ORTHOLOGY (1)   
   RefGene (7)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   OC (1)   
Protein sequence (5)   
   UniProt (1)   
   RefSeq(pep) (4)   
DNA sequence (8)   
   RefSeq(nuc) (4)   
   GenBank (2)   
   EMBL (2)   
Protein domain (9)   
   Pfam (9)   
All databases (118)   

Download RDF
DBGET integrated database retrieval system