KEGG   Cricetulus griseus (Chinese hamster): 100769139Help
Entry
100769139         CDS       T02813                                 

Definition
(RefSeq) chymotrypsinogen B
  KO
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100769139
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100769139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 263 aa AA seqDB search
MAFLWLLSCFALVGATFGCGVPAIHPVLAGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDAENIQVLKIAKVFKNPKFNMLTVRND
ITLLKLATPAQFSETVSAVCLPNADDDFPPGTVCATTGWGRTKYNALKTPDKLQQAALPI
VSTAECKKHWGSKITDVMICAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCST
STPAVYARVTALVPWVHEILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctttggctcttgtcctgctttgcccttgtgggggccacctttggctgtggg
gtccctgccatccaccctgtgctggccggtctatccaggatcgtcaatggagaggatgct
atccctggctcctggccctggcaggtgtccctgcaggacaagactggctttcacttctgc
gggggctccctcatcagtgaagactgggtggtcactgccgcccactgtggagtcaagaca
tctgatgtggtggtagctggagagtttgaccagggctctgacgcagagaacatccaggtt
ctgaagatcgcaaaggttttcaagaatcccaagttcaatatgctcactgtacgcaatgac
atcaccctgctcaagctggccactcctgcccagttctctgagactgtgtctgctgtgtgt
ctgcccaatgctgatgatgacttccctcctgggacagtgtgtgccaccactggctggggc
aggaccaagtacaatgccctcaagactcctgacaagctgcaacaggcagccctgcccatc
gtgtccaccgctgaatgcaagaagcactggggatctaagatcaccgacgtgatgatctgc
gcaggcgccagtggtgtctcctcctgcatgggtgactctggtggccctcttgtctgccag
aaggatggagtctggaccctggcaggtattgtgtcttggggcagtggcgtctgttctacc
tccactcccgccgtgtatgcccgagtcacagcccttgtaccttgggttcatgagatcttg
gaagccaactga

DBGET integrated database retrieval system