KEGG   Cryptococcus gattii: CGB_B8100WHelp
Entry
CGB_B8100W        CDS       T02232                                 

Definition
longevity-assurance protein-like protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cgi  Cryptococcus gattii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CGB_B8100W
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CGB_B8100W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:join(1941270..1941650,1941704..1941991,1942046..1942465)
Genome map
AA seq 362 aa AA seqDB search
MAYNLTASAIPSLIHSHVPQSLRPFVTLSYPITDPLAHPSAQTLYDKGPQDAYFVVFWAI
AFTVLREVFMKGLFSPFMRICLRSPPKIKGQEREYAKARKKREHIVTRFAEQGWSWLYCS
VYWTFGVIVLRQNPSPTSPEQLWGTYPAIPLPALTKFYYLSQLGWWFHQLLVINCEKRRR
DHWQMFGHHILTITLIVGSYVMNFTQVGVLIHCLMDFCDILLPLAKMFRYLSLSTLCDLT
FVVFLISWFITRQVGLFLVIRTSYLDAPRFIPFEWAPEQGRFLTYRVYIGFVAMLSILWI
LATAWFYMACNVAIRVVRGMGAEDSRSDEDGSEEDALEQVPESVGTSTATRSQEEADLRK
RK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaacctcaccgcctccgccatcccgtctctcattcattcacatgtcccacaa
tccctgcggccctttgtaaccctgtcatatcccatcaccgaccctctcgcccacccgtct
gcacagacactgtacgacaagggaccgcaagatgcgtatttcgtcgtcttctgggcaata
gcgtttaccgtgctccgggaggtgttcatgaagggtcttttctcgccctttatgagaata
tgtctgcggagcccgccaaagatcaagggacaggagagagaatacgcaaaggctagaaag
aagagggagcatattgttacgaggtttgcagagcaaggttggagctggctgtattgctct
gtatattggacgtttggcgttattgtcctccgtcaaaacccctctccaacgtctcccgaa
cagctttggggcacatacccggccatccctctccctgcacttaccaagttttactatctc
tcccagcttggttggtggttccaccagctgctcgttatcaactgcgagaagcgaagaaga
gatcattggcagatgtttggacaccacatcttgaccattactttgattgtgggaagttat
gtcatgaactttacccaggtcggtgtccttatccactgtcttatggacttttgcgacatt
ctcttaccactcgccaaaatgtttcgctacctctccctctccaccctctgtgacctcaca
ttcgtcgtcttcctcatttcatggttcattactcgacaagtcggtctcttcctcgttatc
cgcacctcctatctcgacgctcccagatttatcccctttgaatgggctcccgaacaaggc
cgatttcttacttaccgggtatacattggttttgtcgccatgctctctatcctctggatt
ctcgcgaccgcatggttttatatggcctgcaacgtcgcaatccgcgtggtacgaggtatg
ggcgccgaagattcgaggagtgatgaggatgggtccgaagaggatgcgttggagcaagtg
ccagagagtgtaggtacttcaaccgcgaccagatctcaagaagaagcagatttgcgaaag
cgaaaatga

DBGET integrated database retrieval system