KEGG   Cryptococcus gattii: CGB_D3400WHelp
Entry
CGB_D3400W        CDS       T02232                                 

Definition
ubiquitin-specific protease
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CGB_D3400W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CGB_D3400W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(803195..803290,803343..803504,803554..803595,803650..803706,803753..803802,803856..804129,804183..804408,804461..804537)
Genome map
AA seq 327 aa AA seqDB search
MADDPSGWSLTESDPQVFTQLLKDLGVKGLQVDDLYSLDAETLATLKPIHALIFLFKYVA
PDAESSQESAGVEVDPLDNGVWFANQVINNSCGTLAALNAVMNIKPQQSVHEDESIQLGS
ELENLREFGAGMQSLDLGHVLSSSDHIREVHNSFSKSSPFSMDPSAFPEREKEDAYHFVA
YLPVNDILYELDGLRRSPIMHAPVEDDWLSTARETIEQRIATYPAGSLMFNLLCVRSAAI
PRLERLLNDPSTPAEQKFILQDQLEHECNKSQKGAMENSLRRHNLLPVVFQLFKSLGESG
MAAKAVEDARTKGKERRERMQAKDEAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgatccttcaggctggtcacttacagagtcagaccctcaggtgtttacccag
ctcctcaaggatttgggcgtaaagggattgcaagtagacgacttgtactccctcgatgcc
gaaacgcttgctaccctaaagcctattcacgcccttatcttcctcttcaaatacgttgca
ccagatgcagagtcctctcaggaaagtgctggtgttgaggttgatcctttagataatggt
gtatggtttgccaatcaggttatcaacaacagctgtggaactcttgcggctcttaatgct
gtcatgaacatcaagcctcaacaatcagttcacgaagatgaatccattcaactcgggagt
gaacttgaaaacctccgagaatttggtgcgggcatgcagtccctcgatctcggccacgtt
ctttcctcgtctgatcacatccgtgaggtccacaactcattctccaaatcctctcctttt
tctatggacccttcagccttcccagaaagagaaaaggaggatgcctatcatttcgttgcc
tacttgcctgtcaatgatatcttgtacgagctggacggcttgagaaggtctcctatcatg
cacgctcctgttgaggatgactggctcagtaccgctagggaaacgattgaacagagaatt
gcaacctatcctgctggatctctcatgttcaaccttctctgtgtccggtctgctgccatt
ccccgacttgaacggctcctcaacgacccctcaacccccgccgagcaaaagtttatcctc
caagatcaactcgaacacgaatgcaacaagtcacaaaagggggccatggaaaattctttg
agaagacacaacttgctccctgtcgtttttcaactgttcaagtcattgggcgaaagtggt
atggccgccaaggctgtcgaggacgctcgaacaaagggaaaagaaaggcgggaaagaatg
caggccaaggacgaggccaagtaa

DBGET integrated database retrieval system