KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1813Help
Entry
Calhy_1813        CDS       T01346                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00010  Glycolysis / Gluconeogenesis
chd00020  Citrate cycle (TCA cycle)
chd00620  Pyruvate metabolism
chd00633  Nitrotoluene degradation
chd00640  Propanoate metabolism
chd00650  Butanoate metabolism
chd00680  Methane metabolism
chd01100  Metabolic pathways
chd01120  Microbial metabolism in diverse environments
chd01130  Biosynthesis of antibiotics
chd01200  Carbon metabolism
Module
chd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calhy_1813
   00020 Citrate cycle (TCA cycle)
    Calhy_1813
   00620 Pyruvate metabolism
    Calhy_1813
   00640 Propanoate metabolism
    Calhy_1813
   00650 Butanoate metabolism
    Calhy_1813
  Energy metabolism
   00680 Methane metabolism
    Calhy_1813
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calhy_1813
Enzymes [BR:chd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calhy_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADQ07524
UniProt: E4QD30
Position
complement(1836981..1837919)
Genome map
AA seq 312 aa AA seqDB search
MAYNIKELAARPERFTGGHRMCAGCGAPVAVRAVLRALKPEDRAVVGVATGCLEVSSCIY
PYTAWKDSFIHSAFENAAATVAGAEAAYRVLKKKGKIQGEFKFIAFGGDGGTYDIGLQSL
SGAMERGHNMVYVCYDNGAYMNTGIQRSSATPLYADTTTSPQGKVLPGKMQWRKDLTEVM
VAHGIPYVAQTAFITPNLKDLIEKAEKALYTDGPAFLNVLAPCPRGWRYETSKLIEISKL
AVDTCFWPLYEVVNGQYRLTYKPKEKLPVVEFLKTQGRFRHLFKKGNEHLIEQIQQEVDR
RWERLLELCGEK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaatataaaagagcttgctgcaagacctgaaaggtttacaggcgggcacaga
atgtgtgcagggtgcggtgcacctgttgctgtaagagcagtgctcagagcactcaaacca
gaagatagggctgttgttggtgttgcaacaggatgtttggaggtttcaagctgtatttac
ccatacacagcatggaaagactcattcatccacagtgcgtttgagaacgctgctgcaaca
gttgctggtgctgaggctgcatacagggttttaaagaaaaaaggaaaaatccagggtgag
tttaagtttatcgcgtttggcggcgacggtggaacatacgatattggtcttcagtctctc
tctggtgcaatggaaagaggacacaacatggtatatgtctgctatgacaacggtgcttat
atgaacacaggtatccagagatcttctgctacaccactttacgctgatacaacaacatct
ccacagggaaaagtgcttccaggtaagatgcagtggagaaaggatttaacagaagtcatg
gttgcgcatggaattccgtatgttgcacagacagctttcatcacaccaaacctcaaagac
ttaattgaaaaggctgaaaaggctctttacacagatggaccagcatttttaaatgttttg
gctccgtgtccaagaggttggagatatgagacttctaagctcattgaaatttcaaagctt
gcggttgatacatgtttctggccgctttatgaggttgtaaatggtcagtacagactcaca
tacaagccaaaagaaaagcttcctgttgttgagtttttaaagactcaaggaaggttcaga
cacctgttcaaaaaaggaaatgaacatttgattgagcagattcagcaggaagttgacaga
agatgggaaagacttttagagctttgtggtgaaaaataa

DBGET integrated database retrieval system