KEGG   Chlamydia psittaci RD1: Cpsi_8301Help
Entry
Cpsi_8301         CDS       T02153                                 

Definition
putative sulfur metabolism-related protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
chr  Chlamydia psittaci RD1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:chr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965135..966115
Genome map
AA seq 326 aa AA seqDB search
MPSHLLDYQRVAESIVEKTIAELIHYRQRLPLVPFWTKPDGSFVTPADYAVQYCLQKKLS
TTFPHIPFIGEEVLDPVSDKHKINSILEFIHRLDSQVTPEDLLETLSPNQEASTLYWLVD
PIDGTSGFIKNRFFASAVSLIYEDKPILAVMACPCTDRHTFKIYSAAKNYGVSLFGTAIE
TRHYLKSGETLTGKFCEASLAARNQQHHATRLLSLSLPGQPQACRVDSQYKYAMVAEGAV
DFFIRYPFAISQARAWDHAPGAFLVEESGGVVSDIFGNSLNYRREDFILENHPIILASGN
AEIHRITLDALQEQANIVSEENLLAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatttactagactatcaaagagttgcagaaagtatagttgagaaaaccatc
gccgagttaatccattatcgacaacgccttccgctagtccctttctggacaaaacccgac
gggtcttttgtcacacccgcagattatgctgtccaatactgccttcaaaaaaagctatca
acaacttttccacatattccgtttatcggggaagaagtcttagaccctgtaagcgataaa
cataaaattaatagtattttagaattcattcacagactagattcgcaggtgacacctgag
gatcttttagaaacattaagccccaatcaagaagcctcgactttatactggcttgttgat
cctattgatggtacgtcaggatttattaaaaaccgtttttttgcctctgcagtatcctta
atttatgaggataagcctatactcgcggttatggcgtgcccatgcacagaccgccatact
tttaaaatctattctgctgctaaaaactatggggtttctttatttggtacggcaattgaa
actcggcattatttaaaatctggagaaacgctaacggggaagttttgtgaagcatctcta
gctgcacgtaaccaacagcaccacgctacacgcttattaagtctctccttgccagggcaa
ccccaagcttgtcgagttgacagtcaatacaaatatgctatggttgctgaaggcgctgta
gacttttttatccgctacccctttgctatttctcaagcaagagcgtgggatcatgctcca
ggggcttttttagtagaagagtctgggggcgtagtttccgatatttttggaaattcgctc
aactatcgtcgagaagatttcattttagaaaaccatcccataattctagcttccgggaat
gcggaaattcacagaattacgttagacgccttacaagaacaagcaaacattgtttctgaa
gaaaacttgctagcttactaa

DBGET integrated database retrieval system