KEGG   Capra hircus (goat): 102172432Help
Entry
102172432         CDS       T02910                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
chx  Capra hircus (goat)
Pathway
chx00040  Pentose and glucuronate interconversions
chx00053  Ascorbate and aldarate metabolism
chx00140  Steroid hormone biosynthesis
chx00830  Retinol metabolism
chx00860  Porphyrin and chlorophyll metabolism
chx00980  Metabolism of xenobiotics by cytochrome P450
chx00982  Drug metabolism - cytochrome P450
chx00983  Drug metabolism - other enzymes
chx01100  Metabolic pathways
chx05204  Chemical carcinogenesis
Module
chx_M00014  Glucuronate pathway (uronate pathway)
chx_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102172432
   00053 Ascorbate and aldarate metabolism
    102172432
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102172432
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102172432
   00860 Porphyrin and chlorophyll metabolism
    102172432
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102172432
   00982 Drug metabolism - cytochrome P450
    102172432
   00983 Drug metabolism - other enzymes
    102172432
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102172432
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102172432
Glycosyltransferases [BR:chx01003]
 Others
  Hydrophobic molecule
   102172432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 ArsA_ATPase
Motif
Other DBs
NCBI-GeneID: 102172432
NCBI-ProteinID: XP_005701732
Position
6
AA seq 531 aa AA seqDB search
MNKMPMKWLLLLQLLQLTCYFTSGSCGKVLVWPVEFSHWMNMKTILDELVTRGHEVTVLE
SSASTLIDPNKPLAMKFETFPVSLTRDDFQALAKILIETWMLAAKESFWIHLSTIQSLFD
EFSDIGVKICKEAVSNKKLMKKLQESKFDVILADAVGPCGELLAEILKVPLVYSLYFSPG
YSVEKRSGKLSFPPSYVPVMMSELSDHMTFIERVKNMIYVLYFDYWFQLFDEKWNQFYSE
VLGRSTTLSELMGKAEMWLIRNYWDFSFPRPRLPNVEFVGGLHCKPAKPLPKEMEEFVQS
SGEHGIVVFSLGSMVSNMSEERANVIASALAQIPQKVLWRYDGKKPDTLGPNTRLYKWMP
QNDLLGHPKTKAFITHGGSNGIYEAIYHGIPMVGLPLFADQPHNIVHMTAKGAAIRLNLE
TMSTEDLLNALKDVINNPFYKENVMRLSAIQHDQPMKPLDRAIFWIEFVMRHRGAKHLRP
AAHNLTWFQYHSLDVIGFLLACVATVVFVITKCCLFCCRKFASIGKKGKKD
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgcctatgaaatggctcttgcttctgcagctgttacagctcacttgctat
tttacctctgggagttgtggaaaggtgctagtgtggccagtggaatttagtcactggatg
aatatgaagacaattctggatgaacttgtgacgaggggtcatgaagtgactgtactggaa
tcttcagcttccactcttattgatccaaacaaaccattggctatgaaatttgagactttc
cctgtatctttaactagagatgattttcaggctcttgccaagattttgattgagacatgg
atgcttgcggcgaaagaatccttttggatccatctttcaacaatacaaagtctatttgat
gaattttctgatattggtgtgaagatatgtaaagaagctgtttcaaacaagaaacttatg
aaaaaactacaggaatcaaagtttgatgtcattcttgcagatgctgttggaccctgtgga
gagctgctggctgagatacttaaagtacctttagtatacagcctctacttctcacctggc
tattccgttgaaaagaggagtggaaaactttcatttccaccatcctatgtacctgttatg
atgtctgaattaagtgatcacatgacattcatagagagggtcaaaaatatgatatatgta
ctttattttgactactggtttcagctgttcgatgagaagtggaatcagttttacagtgaa
gtactaggaaggtccactacattatcagagttgatggggaaagctgaaatgtggcttatt
cgaaactattgggatttttcatttcctcgcccacggctaccaaatgttgaatttgtagga
ggcctccactgcaaacctgccaaacccctgcctaaggaaatggaagaatttgtgcagagc
tctggagaacatggtattgtggtgttttcgttggggtcaatggtcagtaacatgtcagaa
gaaagagccaatgtgattgcatcagcccttgcccagattccacaaaaggttctatggaga
tacgatggcaagaaaccagacaccttaggacccaatactcggctgtataagtggatgccc
cagaatgaccttcttggtcatccaaaaaccaaagcctttataactcatggtggaagcaat
ggcatttatgaagccatctaccacggaatccctatggtgggccttcctttgtttgctgat
caacctcataacattgttcatatgacggctaagggagcagctatcagactgaacttggaa
acaatgtcaacagaagatttgctcaatgcattgaaagacgtcattaataatcctttctac
aaagagaatgtcatgaggttatcagccattcaacatgatcagcctatgaaacccttggac
cgagcgatcttctggattgaatttgtcatgcggcacagaggagccaagcacctgcggcca
gctgcccacaacctcacctggttccagtaccactctctggatgtgattgggtttctgctg
gcctgtgtggcaactgttgtatttgtcattacaaagtgttgtctattttgttgccggaag
tttgctagcataggaaagaagggcaaaaaagactag

DBGET integrated database retrieval system