KEGG   Coccidioides immitis: CIMG_06092Help
Entry
CIMG_06092        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cim  Coccidioides immitis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CIMG_06092
Enzymes [BR:cim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CIMG_06092
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CIMG_06092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MMENGPPSEEYYLPRDSRQRRPDDRREIELLHYVYSRPNLEELRGCPEKVLGAIDEFGKK
KAYLMNVGQRKGKIVTSLIEEVKPQVMIELGSYVGYSAILFGDALRRVGGKKYYTLEKSP
EYAAVANMLLDLAGLRDFVKVLVGSSDVLLHKLCTTGEIITIELMFLDHFKPAYTTDLKL
CEQLGMVAAGTVLAADNMIMPGNPVYLDYVRSSVETKRSKAKTSPSGYEIFSQNIMSWYV
DKDAKPAFDAVGNPNLIYESRLVESFEPSGEPLCPRCFTCVKPLSNKIATVECDKTIELR
GRVINLDRLYAID
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaacggaccccctagtgaggagtattaccttcctcgagactcgaggcaaagg
agacctgacgaccgacgcgagatcgaattgctccactatgtctatagccggccaaatctt
gaggaattaagaggctgtccagagaaggttctgggggcgattgatgagtttggcaagaaa
aaagcatacttgatgaatgtaggccaacgcaaggggaaaattgttaccagcctcatcgag
gaggttaaaccacaggtgatgatcgagcttgggtcttatgtcgggtactctgccattctg
tttggggatgctctgcgtcgtgtgggcggcaagaagtactacaccttggagaagagtcct
gaatatgctgccgtcgccaatatgctgcttgatcttgccggcttgcgagactttgttaag
gtcttggtcgggagtagcgacgttttgctgcataaattatgcaccaccggcgagattatc
acaatcgaactcatgttcctcgaccatttcaagcctgcctataccactgatttgaaactc
tgtgagcaactcggcatggttgcagctgggaccgtccttgccgctgataacatgatcatg
cctggtaacccggtatatttggattacgtgcgaagcagcgttgaaaccaagaggagcaag
gcgaaaacgtctcctagtggatatgagatattctctcagaacatcatgtcttggtatgtc
gacaaagatgcgaaaccagcgttcgatgccgtcggtaatccgaatttgatttacgaaagc
cggttggtcgagagctttgaaccatctggagagcccctatgccctcgatgcttcacctgc
gttaaaccactttcgaacaaaattgcaaccgtggaatgcgataagaccatcgaattgcgt
ggtagagtgataaacctcgacaggttgtatgctattgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system