KEGG   Coccidioides immitis: CIMG_06275Help
Entry
CIMG_06275        CDS       T01114                                 

Definition
similar to glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cim  Coccidioides immitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIMG_06275
Enzymes [BR:cim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CIMG_06275
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMG_06275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 673 aa AA seqDB search
MAYRAMWKGNTLTLVQTARAMSNGQRVIDLDPYLRPYEDALKNRYKRTTECIEKINRLEG
GLDRFSKGYERLGLNVQSNGDIVYREWAPNATDAHLIGDFNNWNRTATPMKKDAFGVWEV
TVPARNGVPAIPHESKIKITMMTPDGEHIDRIPAWIKRVVQDLDVSPVYEGLFWNPPDED
KYQFKNPRLKKPESLRIYEAHVGISSPEPAVATYKNFTEKMLPRIKYLGYNAIQLMAIME
HAYYASFGYQVNNFFAASSRYGNPEDLKELIDTAHELGLVVLLDVVHSHASKNVLDGLNM
FDGTDHLYFHSGPKGNHDLWDSRLFNYGHHEVLRFLLSNLRFWMEEYQFDGFRFDGVTSM
LYTHHGIGTGFSGGYHEYFGPAVDEDGLTYLMLANEMLHQLYPNCITVAEDVSGMPALCL
PFSLGGVGFDYRLAMAIPDMYIKLLKEKRDEEWDMGNLAFTLTNRRHGEKTIAYAESHDQ
ALVGDKTLMMWLCDKEMYTNILGGEGYLNFEGNEFGHPEWLDFPRAGNNNSFWYARRLLN
LTEDSLLRYKFLNEFDRKMQLTEEKYGWLHAPQAYISLKHEEDKVIVFERAGLLWVFNFN
PTKSFADYRVGVEQPGTYRIVIDTDDCEFGGFNRNAKDTRFFTTGEAWNGRKNYVQVYIP
SRTAVVLALESSL
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcgggctatgtggaaaggtaatacgttaactttggtgcagactgccagagca
atgagcaatggtcaaagggttatcgatctagatccgtacctacgaccctatgaagacgcg
ctaaagaacaggtacaagcgtacaacagagtgtattgagaagataaataggctggagggt
ggacttgataggtttagcaaaggatatgagagactcgggctgaatgtgcaaagcaatggt
gatatagtctaccgggaatgggcgccaaatgctactgatgctcatctcattggggatttc
aataactggaatcgtacggcgacgccgatgaagaaagatgcctttggggtgtgggaggtc
accgtccccgcgcgcaatggagtgccggcaataccacatgaaagcaaaattaagatcacg
atgatgacccctgacggggagcatattgaccgcatcccagcatggatcaagagagtcgtc
caggaccttgatgtctcacctgtctacgaagggctattttggaaccctcctgatgaagac
aaataccaatttaagaatccccggcttaagaaaccggagagcttgagaatatatgaggct
catgtcggtatatcttcaccagaaccggccgttgcaacctacaagaacttcacggagaag
atgttgccgcgtattaaataccttggctataatgcgattcagctgatggcaatcatggag
catgcatattatgctagctttggataccaggtcaacaacttctttgccgcaagtagtcga
tacgggaatcccgaagatttgaaagagcttatagatactgcccatgaactgggattagtc
gttcttctcgacgtggttcacagccatgcgtcaaaaaatgtcctagatgggttgaatatg
tttgatgggaccgatcacctctattttcattctggaccgaaagggaaccatgatctttgg
gacagccgtctcttcaactatgggcatcatgaagttcttcgattcctcttaagcaatttg
cgcttctggatggaagaatatcaattcgatggcttccgctttgacggtgtcacaagtatg
ctctatacacatcatgggattggaactggattctctggtggttaccatgaatatttcggg
ccggccgtcgacgaagacggcttaacatatctcatgctggcaaacgaaatgctccaccaa
ctctacccgaactgcatcacggtggcagaggatgtatcaggaatgccggcgctgtgtttg
ccattttccctcggaggtgttgggtttgactaccggctggcgatggcaattcctgacatg
tacatcaagcttctgaaggagaaacgagatgaagagtgggatatgggcaatctcgctttt
actctgacaaatcgccgccacggagaaaaaacaatagcatacgctgaaagccacgaccag
gcgctggtgggtgataagacgctgatgatgtggctttgcgacaaggaaatgtacacaaat
atcctcggaggcgaagggtatctgaattttgaaggaaacgagtttggccatcctgaatgg
cttgactttccccgtgctggaaataacaatagcttctggtatgctcggaggttattgaac
ctgaccgaggatagtcttctgcgttacaaatttctcaacgagttcgatcgcaagatgcag
ttgaccgaagagaaatatggatggctccatgcaccgcaagcatatattagcctcaaacac
gaggaggataaagtcattgtgttcgagcgggcagggttgctatgggtgttcaacttcaat
ccaaccaaaagctttgcggactatcgagtcggggtcgaacagccaggcacatatcggatc
gttatcgacaccgatgattgcgagtttggcgggttcaaccgcaacgcgaaggatacaaga
ttcttcaccactggcgaggcgtggaatggacgcaagaactatgtgcaagtgtacatccct
tcgcggaccgcagtggtccttgcacttgaaagctctctttag

DBGET integrated database retrieval system