KEGG   Coccidioides immitis: CIMG_06454Help
Entry
CIMG_06454        CDS       T01114                                 

Definition
similar to glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cim  Coccidioides immitis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIMG_06454
Enzymes [BR:cim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CIMG_06454
Glycosyltransferases [BR:cim01003]
 Polysaccharide
  Storage polysaccharide
   CIMG_06454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 714 aa AA seqDB search
MAGNQGARQPPVLKRDVKSHILFEISTEVANRVGGIYSVLKSKAQVTTAEYGDRYTLIGP
WNRASAVVEVESLTPTNPHLAGAIDAMKERGIDIEYGRWLIEGAPRVILIDTGAGYQFLD
EWKGDLWNAAGIPSPPGDSETNEAIVFGYLVAWFLGEYICRDMDLAVIAHFHEWLAGVAL
PLTKKRRMDLTTIFTTHATLLGRYLCAGSVDFYNNLQIFDVDEEAGKRGIYHRYCIERAA
AHSADVFTTVSHITAYESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSHSKEKIHDFV
RGHFYGHNDFDLENTLYFFIAGRYEYRNKGVDMFIESLARLNHRLKETGSTTTIVAFIIM
PAQTSSLTVEALKGQAVVKSLRDTLEMVEKGIGKRLFERCLSWREGDNMPDEKDLITAQD
KVLIRRRLFAMKRHSLPPIVTHNMLNDSEDPILNQLRRVQLFNYSTDRVKIVFHPEFLNS
SNPVLPLDYDDFVRGTNLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIEN
SSDYGIYIVDRRLKGVDDSVNQLTQYMFEFASKSRRQRINQRNRTERLSDLLDWKRMGLE
YVKARQLALRRAYPMSFDPEEDFRDIIGGTEQKISRPLSIPGSPRDRSGMMTPGDFASLQ
EGREGLSTDDYVSWKLPDEEEADEYPFPIALRTRTKEKVEPPHSPDRDVAPNGS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaatcaaggtgcacgtcagccgccggtgctaaaacgcgatgtcaagagccac
attctcttcgagatctcgactgaagttgcgaacagagtgggtggcatttactcggtcctc
aagtccaaagcccaagtaaccaccgctgaatatggtgaccgatatacgttgattgggccc
tggaatagagcttcggccgttgtcgaagttgagtcacttacgcccaccaatccgcacctc
gctggggcgatagatgcgatgaaagaaagaggcattgatatcgaatatggaagatggcta
attgaaggcgctccacgagttattttgattgacaccggtgccggttatcagttcctagat
gaatggaaaggcgatctctggaatgccgccggcattccatctcctccaggggatagcgaa
accaacgaagccattgttttcggatacttggtcgcgtggttcctaggcgagtatatatgc
agagatatggatcttgcggtaatcgctcactttcacgagtggcttgctggcgtcgctctc
cccctgaccaagaaaaggcgcatggatctaacgacaatattcaccacgcatgccaccctt
ctcggaagatacctttgcgctggctctgttgacttctataataatctgcaaatctttgat
gtcgacgaggaggctggaaagcgtggaatataccaccgatactgcatcgaacgggccgcg
gcccattcagcagatgtcttcactaccgtttcccacattactgcatatgaaagcgagcat
ttgctcaaacgaaagcctgatggcgtattgccaaacggtctaaacgtgaagaagttttca
gccgtccacgaattccagaatctccattcgcattctaaagagaagatccatgactttgta
cgaggtcatttctatggccataacgactttgacctcgaaaacacactctacttcttcatc
gctggccgctatgagtatagaaacaagggggtggatatgtttatcgaatcgctggcgcgt
cttaaccaccgtttaaaggaaactggatcgactactaccatcgtcgcatttatcattatg
cccgctcaaacatcgtctcttactgttgaggctctaaaaggtcaggcggttgttaaatca
ctacgagatacactagaaatggtggagaagggaatcgggaagcgcctgtttgagcggtgt
ttaagctggcgtgaaggtgacaacatgccagacgagaaggatctcatcaccgctcaagat
aaggtcctcatccgtcgccggctctttgctatgaagcgtcatagcttgcccccaattgtg
acccataacatgctaaatgactccgaggacccaattctaaaccagctccgtagggtgcag
ctgtttaactattcaacggatcgcgtgaaaatagtatttcaccccgagttcctgaactcc
tcgaatccagtgcttcctttggactatgacgactttgttcgtggcacgaatctcggagtg
ttcccttcgtactacgagccctgggggtatactccggccgagtgtacggtaatgggcgtc
ccaagcatcactaccaatctctcaggttttgggtgctatatggaggagcttattgaaaat
tcctctgattatggaatctatattgtggatcgccgtttaaaaggtgtggacgattcggtt
aatcagctcacccagtacatgtttgagtttgcgagtaagagcagaagacagcgtatcaac
cagagaaacagaactgagagactaagcgatctactggactggaagagaatgggattggag
tatgtgaaggcgaggcagctggctctgcgacgggcatacccgatgtctttcgacccagaa
gaagacttccgtgatattatcggcggaacagagcaaaagatatcgcgcccgctctccatc
cctggatctccgcgtgatcgctcgggaatgatgacaccgggtgattttgcatcactgcag
gaaggacgagaagggctgagcacagatgattatgtatcttggaagctgcctgatgaagag
gaagccgatgagtacccatttcccattgctcttagaaccagaacaaaagaaaaggtcgaa
cctccccattctcctgatcgggatgtggctccgaatggcagctag

DBGET integrated database retrieval system