KEGG   Ciona intestinalis (sea squirt): 100181433Help
Entry
100181433         CDS       T01056                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100181433
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100181433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 313 aa AA seqDB search
MDNSDIVVVGSCNMDLVTYTPRLPLKGESIHGHRYVTGFGGKGANQCVAATKLGAKTSMV
SRVGEDSHGEQYIENFKTLKVNTDHVIKTKNETTGVAPITVADDGSNCLVIVPGANMILS
SDDVEQAYNCIKNCKVLLCQLEVQPSTSLHALKLAKSLGITTIFTPAPAPVAKLDEKFFE
YADVICPNETEAEALTGIAVTDTESGKKAAQVLVKKGCQIGIVTLGQNGCVFAEKSTNKV
VHVPAPAVKPVDTTGAGDAFTGALAFYLARFPELPTEEKLQRSCQVASFSVCRNGTQTSY
PFHHELPKKLTSA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggataattcagacattgtggtagttggttcatgtaatatggatctcgtgacatacact
ccccgtttacctttaaaaggtgaatccattcacggacataggtatgtcactggatttggt
ggaaaaggtgcaaaccaatgtgtggctgctacaaaacttggtgcaaaaacttccatggtt
tcacgtgtcggtgaggacagccatggggagcaatatattgagaattttaaaactttgaaa
gtaaacacagatcatgttataaaaacaaagaatgagacaactggggtagcgcccattaca
gttgctgatgatggaagcaactgtcttgtgattgtccccggagcaaatatgatcttatcc
tcagatgacgttgaacaagcttataattgtataaagaattgcaaggttttgctctgtcaa
ttagaagtgcaaccatccacttcacttcatgctcttaaattagccaaatcacttggtatt
acaacgatattcacccctgcacctgcccctgtggccaaacttgacgaaaagttttttgag
tatgctgatgtgatttgtcccaatgaaacagaggctgaagccttaacaggaatcgcggtg
actgacactgaaagtggaaaaaaggcagctcaagttctggtaaaaaaaggttgtcaaata
ggaattgtcacccttggccagaacggttgtgtttttgctgaaaaatctacaaataaagtt
gttcatgttccagccccagcagtaaagcctgttgatacaacaggtgctggagatgcattt
actggagctcttgcattttatcttgctcggtttcctgaattgccaaccgaggaaaaattg
cagaggtcgtgtcaagttgcaagtttcagtgtctgtcggaatggtacacagacaagttac
ccttttcatcacgaacttcccaaaaaattaacttccgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system