KEGG   Ciona intestinalis (sea squirt): 100184986Help
Entry
100184986         CDS       T01056                                 

Definition
Cytochrome c, somatic-like
Orthology
K08738  
cytochrome c
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100184986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 110 aa AA seqDB search
MGKKAAAGDVEKGKKIFIQKCKQCHTYTSDCTNKTGPTLHGLFGRQSGQVAGFDYTDQNR
DKGVIWGEDTLDVYLTNPAKYIPGTKMVFAGIKKKGERADLIAFLKDATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaagcagcagctggagatgttgaaaaaggaaagaaaatctttattcaaaaa
tgcaaacagtgtcatacctacacctctgattgtaccaacaaaactggtccaaccttgcat
ggtttgtttggcagacaaagtggacaagttgcaggatttgattacaccgaccaaaaccga
gacaagggagtgatctggggtgaagatacacttgatgtttacttgacaaacccagctaaa
tatattccaggaaccaaaatggttttcgctggaattaagaaaaagggagaacgagctgac
ctcatcgcttttcttaaggatgctacaaagtag

DBGET integrated database retrieval system