KEGG   Ciona intestinalis (sea squirt): 100187292Help
Entry
100187292         CDS       T01056                                 

Definition
alcohol dehydrogenase 2-like
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    100187292
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100187292
  Lipid metabolism
   00071 Fatty acid degradation
    100187292
  Amino acid metabolism
   00350 Tyrosine metabolism
    100187292
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100187292
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100187292
   00982 Drug metabolism - cytochrome P450
    100187292
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100187292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 378 aa AA seqDB search
MMKKAEIVGLNKPLRIVQVDIPATPKKGAIVKVAYSGVCHSDIHQWDDCIDLGNTKIGLS
DAIGYKLPVVPGHEISGTVYSIGEEADAAAGLKVGDRVAVYPWIGCSKCGVCTHGKSECC
KERQLTIIGVGASSGGHSTHVAVTEVQFVVKLPDSIPLDLACMLPCSGLTTYNAVTSVLD
TVEKATLYHGKASVLIIGAGGLGLWSLRLAQALFPPTTEITVADISEEKLKVAKDRGCHD
TVFWDRSLSAADLHKATISKGNKGGFDAIMDFVNSQVTAERAFRCLKPYGLHVMVGLFGG
AATFPLPMLTLGARQIKGVYVGSLQQFNELIDLVSKNKLDPPPLNYFKLNDVTKAFTLLK
EGKINGRGLIKHDDKASL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagcagaaatagtaggattaaacaaacctttacgtatcgtacaagtcgat
attcctgcaactccaaagaaaggagcaatcgtaaaggtagcatacagcggtgtatgtcat
tcagacatacaccaatgggatgactgtatcgaccttggaaataccaaaattggactttcg
gacgccataggatataaactaccagtcgttcctggacatgaaatctcgggaacagtgtat
tctatcggggaagaagcagacgcggcagctggtctaaaggttggtgatcgagtagctgtt
tatccttggattggctgcagcaaatgcggtgtctgcactcacggcaaatcagaatgttgc
aaagaacgacagttgacaattattggtgtgggtgcatcaagcggcggccactctacgcat
gtagcagtcacagaggttcagtttgttgttaaacttcccgattctataccactggacctt
gcttgtatgttgccatgctcgggtcttacaacttacaacgctgtaacaagtgtgttggat
acggtggagaaggcgacactttatcacggaaaagcatctgtgctgatcatcggtgctgga
ggtcttggtttatggagtctcagacttgctcaagctctctttcccccaacaacggaaatc
actgtcgcagatattagcgaggaaaaactgaaagtggcaaaagatagaggatgtcacgat
actgtcttttgggatcgttctctaagtgctgcggatttacacaaggctacaataagcaaa
gggaataaaggcggcttcgatgccatcatggatttcgtgaacagtcaagttactgcggaa
agggcgttcaggtgcttgaaaccgtatggcctgcatgtgatggtcggtttatttggagga
gctgcaacatttcctttaccaatgttgacacttggtgcaagacaaataaaaggagtttac
gtgggatctctgcaacagtttaacgagttaatcgacctggtatctaagaataagttggac
ccaccacctctcaactactttaagttgaacgacgttacaaaggcattcactctgttgaaa
gaaggcaagataaatggacgtgggctgatcaagcacgatgataaagcatctttgtaa

DBGET integrated database retrieval system