KEGG   Ciona intestinalis (sea squirt): 100187292Help
Entry
100187292         CDS       T01056                                 

Definition
NAD-dependent alcohol dehydrogenase-like
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cin01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cin00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cin00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cin00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cin00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:cin00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:cin00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MMKKAEIVGLNKPLRIVQVDIPATPKKGAIVKVAYSGVCHSDIHQWDDCIDLGNTKIGLS
DAIGYKLPVVPGHEISGTVYSIGEEADAAAGLKVGDRVAVYPWIGCSKCGVCTHGKSECC
KERQLTIIGVGASSGGHSTHVAVTEVQFVVKLPDSIPLDLACMLPCSGLTTYNAVTSVLD
TVEKATLYHGKASVLIIGAGGLGLWSLRLAQALFPPTTEITVADISVFGNTVLQVFDKIR
VNSE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagcagaaatagtaggattaaacaaacctttacgtatcgtacaagtcgat
attcctgcaactccaaagaaaggagcaatcgtaaaggtagcatacagcggtgtatgtcat
tcagacatacaccaatgggatgactgtatcgaccttggaaataccaaaattggactttcg
gacgccataggatataaactaccagtcgttcctggacatgaaatctcgggaacagtgtat
tctatcggggaagaagcagacgcggcagctggtctaaaggttggtgatcgagtagctgtt
tatccttggattggctgcagcaaatgcggtgtctgcactcacggcaaatcagaatgttgc
aaagaacgacagttgacaattattggtgtgggtgcatcaagcggcggccactctacgcat
gtagcagtcacagaggttcagtttgttgttaaacttcccgattctataccactggacctt
gcttgtatgttgccatgctcgggtcttacaacttacaacgctgtaacaagtgtgttggat
acggtggagaaggcgacactttatcacggaaaagcatctgtgctgatcatcggtgctgga
ggtcttggtttatggagtctcagacttgctcaagctctctttcccccaacaacggaaatc
actgtcgcagatattagcgtgtttggtaacacagtcttacaggtctttgataagataagg
gttaattctgaataa

DBGET integrated database retrieval system